(data stored in SCRATCH zone)

EMBL: CU928166.PE112

CU928166.PE112       Location/Qualifiers
FT   CDS             complement(227825..228442)
FT                   /locus_tag="KLTH0B02904g"
FT                   /old_locus_tag="KLTH-ORF15612"
FT                   /product="KLTH0B02904p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02904g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21477"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG6"
FT                   /protein_id="CAR21477.1"
FT                   /translation="MTFRLIMVDPSPSSKEHLDFSTEKPESVKQHDARGSSKRRKDLSV
FT                   VMHTFEKGRVEKVSPPCRGICTKKKNHKNAAAAKPSEKRCKKLEGVQDEEKMNSSCVIP
FT                   PKPLTFVTSVASDYSLEYANAWQSSLEFNSKKAQRPLFRITKYKGRKGCEKVESSTELL
FT                   GTIDPNFCFSYNSLNSSKEKGAKTPPMNFSTAPVFKVLLNDR"
     MTFRLIMVDP SPSSKEHLDF STEKPESVKQ HDARGSSKRR KDLSVVMHTF EKGRVEKVSP        60
     PCRGICTKKK NHKNAAAAKP SEKRCKKLEG VQDEEKMNSS CVIPPKPLTF VTSVASDYSL       120
     EYANAWQSSL EFNSKKAQRP LFRITKYKGR KGCEKVESST ELLGTIDPNF CFSYNSLNSS       180
     KEKGAKTPPM NFSTAPVFKV LLNDR                                             205
//

If you have problems or comments...

PBIL Back to PBIL home page