(data stored in SCRATCH zone)

EMBL: CU928166.PE113

CU928166.PE113       Location/Qualifiers
FT   CDS             228615..230591
FT                   /locus_tag="KLTH0B02926g"
FT                   /old_locus_tag="KLTH-ORF15610"
FT                   /product="KLTH0B02926p"
FT                   /note="similar to uniprot|Q92280 Saccharomyces cerevisiae
FT                   YLR002C NOC3 Protein that forms a nuclear complex with
FT                   Noc2p that binds to 66S ribosomal precursors to mediate
FT                   their intranuclear transport also binds to chromatin to
FT                   promote the association of DNA replication factors and
FT                   replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02926g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21478"
FT                   /db_xref="GOA:C5DCG7"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR011501"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016903"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCG7"
FT                   /protein_id="CAR21478.1"
FT                   /translation="MGSKKRSQRVAEDKASKRRKEQDSLLEGGIFTREDVQEIEDSIPA
FT                   KKSWDDEEQDYERKPRKLAGYPEDNIEQLPIKIGAKVERRIVRAPKVEPESNNDDSEDV
FT                   DLMKNDDEEQSTEADDSAVADSPEAVLQLKEQIAELVENIMEDAEENVGSLTRLRKMAQ
FT                   SKNSNTCKFSLLALIPVFKSVIPSYKIRPLSDAEKKEKVSKEVAKLRNFEEHLVRNYKE
FT                   YIDLLSKLAKTPNSADQKQVAMGNLAANALVELLPSASNFNFSTEVFTAIIRRICKPNP
FT                   LADPVYQKMVKALETLLNEDDDGRNSLEIVRILAKTIKSRSYMIDESVLNILLSLDVLQ
FT                   DFDPNTKDEDFTKVKVKKKDRAHLSKKQRKVRKEMKKVEEEMQKAEQTVLAEEREKNQA
FT                   EILKFTLSLYLNILKSNVAKLIGSVLEGLSKFGHMANFDLLGDFLEVMRELIANSELDN
FT                   LSPLEVRKVLLCIVTAFSLVSRHSQMKLSMDLTSFVDALYSVIPNLSVDAEIEYSHKTL
FT                   RLADPLGSDLVKPSVNVSTKAELLLRALDHVFFRSRSGSKVRAAAFAKRLYVAMLATPE
FT                   KTSIAILKFLEKLMDKYPEVGGLYSTEDRIGNGNFKLQAETPARSNAEAATIWENILLL
FT                   KHYSPAVIKGTKALLEKSRGSLK"
     MGSKKRSQRV AEDKASKRRK EQDSLLEGGI FTREDVQEIE DSIPAKKSWD DEEQDYERKP        60
     RKLAGYPEDN IEQLPIKIGA KVERRIVRAP KVEPESNNDD SEDVDLMKND DEEQSTEADD       120
     SAVADSPEAV LQLKEQIAEL VENIMEDAEE NVGSLTRLRK MAQSKNSNTC KFSLLALIPV       180
     FKSVIPSYKI RPLSDAEKKE KVSKEVAKLR NFEEHLVRNY KEYIDLLSKL AKTPNSADQK       240
     QVAMGNLAAN ALVELLPSAS NFNFSTEVFT AIIRRICKPN PLADPVYQKM VKALETLLNE       300
     DDDGRNSLEI VRILAKTIKS RSYMIDESVL NILLSLDVLQ DFDPNTKDED FTKVKVKKKD       360
     RAHLSKKQRK VRKEMKKVEE EMQKAEQTVL AEEREKNQAE ILKFTLSLYL NILKSNVAKL       420
     IGSVLEGLSK FGHMANFDLL GDFLEVMREL IANSELDNLS PLEVRKVLLC IVTAFSLVSR       480
     HSQMKLSMDL TSFVDALYSV IPNLSVDAEI EYSHKTLRLA DPLGSDLVKP SVNVSTKAEL       540
     LLRALDHVFF RSRSGSKVRA AAFAKRLYVA MLATPEKTSI AILKFLEKLM DKYPEVGGLY       600
     STEDRIGNGN FKLQAETPAR SNAEAATIWE NILLLKHYSP AVIKGTKALL EKSRGSLK         658
//

If you have problems or comments...

PBIL Back to PBIL home page