(data stored in SCRATCH zone)

EMBL: CU928166.PE116

CU928166.PE116       Location/Qualifiers
FT   CDS             complement(234560..235174)
FT                   /locus_tag="KLTH0B02992g"
FT                   /old_locus_tag="KLTH-ORF15600"
FT                   /product="KLTH0B02992p"
FT                   /note="weakly similar to uniprot|P40561 Saccharomyces
FT                   cerevisiae YIR001C SGN1 Cytoplasmic RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B02992g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21481"
FT                   /db_xref="GOA:C5DCH0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH0"
FT                   /protein_id="CAR21481.1"
FT                   /translation="MSDTRWTTSYPHMNEFLSDSSQQDNKPDYYHVITEETSRLKDIEK
FT                   RMAENAHGAGCPGFSRFNDQSADARSVYVGNLDPSINAETLQEFFKGSVSRVNRVEIQI
FT                   NKLTGFAKGFAFVEFAQPRDVMDAIKLSNTKLGGKPLKIVPKRPSFHQESPNRGSHRMR
FT                   RATTRTHPPLRGRPHGRHLHNAWRGNRRGRVRARGRGKRFI"
     MSDTRWTTSY PHMNEFLSDS SQQDNKPDYY HVITEETSRL KDIEKRMAEN AHGAGCPGFS        60
     RFNDQSADAR SVYVGNLDPS INAETLQEFF KGSVSRVNRV EIQINKLTGF AKGFAFVEFA       120
     QPRDVMDAIK LSNTKLGGKP LKIVPKRPSF HQESPNRGSH RMRRATTRTH PPLRGRPHGR       180
     HLHNAWRGNR RGRVRARGRG KRFI                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page