(data stored in ACNUC8465 zone)

EMBL: CU928166.PE122

CU928166.PE122       Location/Qualifiers
FT   CDS             246188..247645
FT                   /locus_tag="KLTH0B03146g"
FT                   /old_locus_tag="KLTH-ORF15585"
FT                   /product="KLTH0B03146p"
FT                   /note="similar to uniprot|P41543 Saccharomyces cerevisiae
FT                   YJL002C OST1 Alpha subunit of the oligosaccharyltransferase
FT                   complex of the ER lumen which catalyzes asparagine-linked
FT                   glycosylation of newly synthesized proteins"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03146g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21487"
FT                   /db_xref="GOA:C5DCH6"
FT                   /db_xref="InterPro:IPR007676"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH6"
FT                   /protein_id="CAR21487.1"
FT                   /translation="MYYKCSSLLKTVGEMLSATRLAAIFLLFLNFVVGDLDAGIIPKLW
FT                   ENLELHRTIDVSRSYTQELVDIRIKNIHDEPVRQYYFVLPEEVFDAISLFSSTLKGVDA
FT                   YIESAIMPEQNFVANGRTIKVGVIGLPSPIEPGHETSILLNLVYNSRYQPYPGHVDLGE
FT                   EQKLLLRTNRFPISAYNTQKYTLEFQGSSSFEELQSFNGEEHAGMVANGKMVVGPFDSI
FT                   MPYEDFSPIEVVFEHNTPLPRVSHLKRDIWVSHWASSLQFEEYYELINDAASLKSGFSR
FT                   ADYMKGQHALKKGGHLTALEMILPDSSEAHYCTDLVGAVSTFKVLKDHFFLKPRYPLFG
FT                   NWKYNFTVGWTNQLSQFLHSQEDGSDTYILSFPILNGPADTVYDSVSLSIYLPEGAEVL
FT                   DVWCPLPVQKTEVTTEKSYFDLNQGHTKVNIELKNLIDRIAGSEAFVRYKVTSTTFYKK
FT                   PFSIAVSVFTALMAYFFLKHISLMIDS"
     MYYKCSSLLK TVGEMLSATR LAAIFLLFLN FVVGDLDAGI IPKLWENLEL HRTIDVSRSY        60
     TQELVDIRIK NIHDEPVRQY YFVLPEEVFD AISLFSSTLK GVDAYIESAI MPEQNFVANG       120
     RTIKVGVIGL PSPIEPGHET SILLNLVYNS RYQPYPGHVD LGEEQKLLLR TNRFPISAYN       180
     TQKYTLEFQG SSSFEELQSF NGEEHAGMVA NGKMVVGPFD SIMPYEDFSP IEVVFEHNTP       240
     LPRVSHLKRD IWVSHWASSL QFEEYYELIN DAASLKSGFS RADYMKGQHA LKKGGHLTAL       300
     EMILPDSSEA HYCTDLVGAV STFKVLKDHF FLKPRYPLFG NWKYNFTVGW TNQLSQFLHS       360
     QEDGSDTYIL SFPILNGPAD TVYDSVSLSI YLPEGAEVLD VWCPLPVQKT EVTTEKSYFD       420
     LNQGHTKVNI ELKNLIDRIA GSEAFVRYKV TSTTFYKKPF SIAVSVFTAL MAYFFLKHIS       480
     LMIDS                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page