(data stored in ACNUC8465 zone)

EMBL: CU928166.PE123

CU928166.PE123       Location/Qualifiers
FT   CDS             complement(247739..249631)
FT                   /locus_tag="KLTH0B03168g"
FT                   /old_locus_tag="KLTH-ORF15583"
FT                   /product="KLTH0B03168p"
FT                   /note="similar to uniprot|P54790 Saccharomyces cerevisiae
FT                   YLL004W ORC3 Subunit of the origin recognition complex
FT                   which directs DNA replication by binding to replication
FT                   origins and is also involved in transcriptional silencing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03168g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21488"
FT                   /db_xref="GOA:C5DCH7"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="InterPro:IPR040855"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCH7"
FT                   /protein_id="CAR21488.1"
FT                   /translation="MSLNEFAEAQKTHYTVCPKVKRRRISCEKGIDPFVKLLAGKESMQ
FT                   MVNKRWVLYHQLHSQFHAQVEEIVHRVSIDMYREISSVLSKDTSKRTSPSFNCLFLLGS
FT                   DSTTTIELHEQNSKTMQAIIDLTPKESPNVRMMLRRSMFKLLSATEAPLRVKTDEKESF
FT                   APEGDMGELPRTSPLGISYDLSLVQNFRKLFGKRLKLIFNFKDVDSFNSQVLDDFIILL
FT                   KSALNYKDVEICLVLNINTNLSNIQKNLRQSTIRLLKKDFTVIDLSHNKGHKYANQTFQ
FT                   SFLNTVDGKLNLSAEFIKFILDKMSNNATHNLQLLIKILDYSLMSYFFQNPFSVFIDPT
FT                   NVVNFDENYLPPLLKCPTFMTFVEGMVHAHAPSEEIMALLDNKNSTLEEFFTEFLVREN
FT                   PINDHLKLVVDVLENQLGVFNYNLIDLYYHMLTGKLHEFLQRWPECQQFEDILKFEPVD
FT                   IIFQELFTLDNSKELFSQSLFPFLRTNLENNLINSDRMLPPAKRLPGIKDPFEAEFNSS
FT                   VDLPLCQLFSLYREASSIINLYDFFLAFKETLPRSEIANFVNYSVENKESDLRHEDREK
FT                   LSILLKEKGLDNLLDKMMLVWFVQSISEFQHMGLLKTQSNKSYEVVEKCIWRGL"
     MSLNEFAEAQ KTHYTVCPKV KRRRISCEKG IDPFVKLLAG KESMQMVNKR WVLYHQLHSQ        60
     FHAQVEEIVH RVSIDMYREI SSVLSKDTSK RTSPSFNCLF LLGSDSTTTI ELHEQNSKTM       120
     QAIIDLTPKE SPNVRMMLRR SMFKLLSATE APLRVKTDEK ESFAPEGDMG ELPRTSPLGI       180
     SYDLSLVQNF RKLFGKRLKL IFNFKDVDSF NSQVLDDFII LLKSALNYKD VEICLVLNIN       240
     TNLSNIQKNL RQSTIRLLKK DFTVIDLSHN KGHKYANQTF QSFLNTVDGK LNLSAEFIKF       300
     ILDKMSNNAT HNLQLLIKIL DYSLMSYFFQ NPFSVFIDPT NVVNFDENYL PPLLKCPTFM       360
     TFVEGMVHAH APSEEIMALL DNKNSTLEEF FTEFLVRENP INDHLKLVVD VLENQLGVFN       420
     YNLIDLYYHM LTGKLHEFLQ RWPECQQFED ILKFEPVDII FQELFTLDNS KELFSQSLFP       480
     FLRTNLENNL INSDRMLPPA KRLPGIKDPF EAEFNSSVDL PLCQLFSLYR EASSIINLYD       540
     FFLAFKETLP RSEIANFVNY SVENKESDLR HEDREKLSIL LKEKGLDNLL DKMMLVWFVQ       600
     SISEFQHMGL LKTQSNKSYE VVEKCIWRGL                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page