(data stored in ACNUC8465 zone)

EMBL: CU928166.PE128

CU928166.PE128       Location/Qualifiers
FT   CDS             complement(257395..259614)
FT                   /locus_tag="KLTH0B03278g"
FT                   /old_locus_tag="KLTH-ORF15574"
FT                   /product="KLTH0B03278p"
FT                   /note="similar to uniprot|P32892 Saccharomyces cerevisiae
FT                   YLL008W DRS1 Nucleolar DEAD-box protein required for
FT                   ribosome assembly and function including synthesis of 60S
FT                   ribosomal subunits"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03278g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21493"
FT                   /db_xref="GOA:C5DCI2"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCI2"
FT                   /protein_id="CAR21493.1"
FT                   /translation="MDKQKFKDFEDFVPTISDSENEVPDLDGSEDETLHPETSTKTKSK
FT                   KKKANNSNPNEDIHEDLNPSFRFDLDGAEVSSGFEGWNFDGDKKLETNPDVDLDGIIRR
FT                   KGGLIQMAGTGDSESDGSEKESESEGELALDGFGMGADEKSSKCQSATHEGDATDSEGD
FT                   ESGVDEDSGVESDKQTEGQEALMTAGNGSVSDIEDDSEEAKAEFYALEEESTEAKKTVH
FT                   TNFNSLSLSRPVLKGLGALNYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAYMIPI
FT                   IERLLYKPAQIASTRVIVLTPTRELAIQVSDVGAKLAKFVNGISFGLAVGGLNLRQQEQ
FT                   TLRSRPDIVIATPGRLIDHIRNSASFNVDSVEILVIDEADRMLEEGFQDELNEIMSLIP
FT                   SKRQTLLFSATMNSKINQLISLSLKKPVKIMIDPPRQAAAKLTQEFVRVRKRDELKPAL
FT                   LFHLIRKLDDLSQKRVVVFVARKEVAHKLRIILGLLGMKVAELHGSLSQEQRLQAVNGF
FT                   KSLQVPVLICTDLASRGLDIPKIEFVINYDMPKTYDIYLHRVGRTARAGREGRSISFVG
FT                   ESSQDRNVVKNAIKSAEENKKQDTVVGRMVDWAKVEEINKLTTNKDDVIAEILEEEKQE
FT                   KEILRAEMEVRKGENMLKHKDEISARPRRTWFQTEGEKKNSKVIQALSKGKKTVNSKKR
FT                   KRIEATEDRSRSYKKTQKDRGSDQQRTYAKQKAKKEMKKKKQARK"
     MDKQKFKDFE DFVPTISDSE NEVPDLDGSE DETLHPETST KTKSKKKKAN NSNPNEDIHE        60
     DLNPSFRFDL DGAEVSSGFE GWNFDGDKKL ETNPDVDLDG IIRRKGGLIQ MAGTGDSESD       120
     GSEKESESEG ELALDGFGMG ADEKSSKCQS ATHEGDATDS EGDESGVDED SGVESDKQTE       180
     GQEALMTAGN GSVSDIEDDS EEAKAEFYAL EEESTEAKKT VHTNFNSLSL SRPVLKGLGA       240
     LNYVKPSPIQ SATIPIALLG KDIIAGAVTG SGKTAAYMIP IIERLLYKPA QIASTRVIVL       300
     TPTRELAIQV SDVGAKLAKF VNGISFGLAV GGLNLRQQEQ TLRSRPDIVI ATPGRLIDHI       360
     RNSASFNVDS VEILVIDEAD RMLEEGFQDE LNEIMSLIPS KRQTLLFSAT MNSKINQLIS       420
     LSLKKPVKIM IDPPRQAAAK LTQEFVRVRK RDELKPALLF HLIRKLDDLS QKRVVVFVAR       480
     KEVAHKLRII LGLLGMKVAE LHGSLSQEQR LQAVNGFKSL QVPVLICTDL ASRGLDIPKI       540
     EFVINYDMPK TYDIYLHRVG RTARAGREGR SISFVGESSQ DRNVVKNAIK SAEENKKQDT       600
     VVGRMVDWAK VEEINKLTTN KDDVIAEILE EEKQEKEILR AEMEVRKGEN MLKHKDEISA       660
     RPRRTWFQTE GEKKNSKVIQ ALSKGKKTVN SKKRKRIEAT EDRSRSYKKT QKDRGSDQQR       720
     TYAKQKAKKE MKKKKQARK                                                    739
//

If you have problems or comments...

PBIL Back to PBIL home page