(data stored in ACNUC8465 zone)

EMBL: CU928166.PE132

CU928166.PE132       Location/Qualifiers
FT   CDS             complement(271449..272618)
FT                   /locus_tag="KLTH0B03366g"
FT                   /old_locus_tag="KLTH-ORF15558"
FT                   /product="KLTH0B03366p"
FT                   /note="weakly similar to uniprot|Q7LGY6 Saccharomyces
FT                   cerevisiae YLR018C POM34 nuclear pore integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03366g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21497"
FT                   /db_xref="InterPro:IPR012578"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCI6"
FT                   /protein_id="CAR21497.1"
FT                   /translation="MSNSAMDNSFEPSSSNSAFSALYRRDFGNAMNSSTVPRKMFSTPV
FT                   KPVTQERFASVREKVVRESPYLYKSKILSSPVKDGKRVSKSVGGTPLARPTVFQKSRPT
FT                   SSESTSNETEAKGTVASENTESVLGGFENPVLAQYSCRIVNKELETRKIISNLLAVLVW
FT                   NLALKFLSLYLDHTLHGAGFSKRVAKWVQETLVYRINPYADFEHSRWARLITLANVSHI
FT                   FHLIIFYNVTVSLWRLLVKSQNVKIDDLHLNQRQKQLLGLSDQTQTSSALPRVVLAASP
FT                   QEPLSKPTSLASSPHKASAPPVFLFKSLQTPLKSKERAAAAERAGVRSERAPKINAFGD
FT                   LRSSVLKKSSLTPSHVSSGLLPTAMNRTGYIPSSKYAYMRDSPSPRKTM"
     MSNSAMDNSF EPSSSNSAFS ALYRRDFGNA MNSSTVPRKM FSTPVKPVTQ ERFASVREKV        60
     VRESPYLYKS KILSSPVKDG KRVSKSVGGT PLARPTVFQK SRPTSSESTS NETEAKGTVA       120
     SENTESVLGG FENPVLAQYS CRIVNKELET RKIISNLLAV LVWNLALKFL SLYLDHTLHG       180
     AGFSKRVAKW VQETLVYRIN PYADFEHSRW ARLITLANVS HIFHLIIFYN VTVSLWRLLV       240
     KSQNVKIDDL HLNQRQKQLL GLSDQTQTSS ALPRVVLAAS PQEPLSKPTS LASSPHKASA       300
     PPVFLFKSLQ TPLKSKERAA AAERAGVRSE RAPKINAFGD LRSSVLKKSS LTPSHVSSGL       360
     LPTAMNRTGY IPSSKYAYMR DSPSPRKTM                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page