(data stored in ACNUC8465 zone)

EMBL: CU928166.PE139

CU928166.PE139       Location/Qualifiers
FT   CDS             284167..286437
FT                   /locus_tag="KLTH0B03520g"
FT                   /old_locus_tag="KLTH-ORF15535"
FT                   /product="KLTH0B03520p"
FT                   /note="some similarities with uniprot|Q02601 Saccharomyces
FT                   cerevisiae YLL013C PUF3 member of the PUF protein family
FT                   which is named for the founding members PUmilio and Fbf"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03520g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21504"
FT                   /db_xref="GOA:C5DCJ3"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR033133"
FT                   /db_xref="InterPro:IPR033712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ3"
FT                   /protein_id="CAR21504.1"
FT                   /translation="MSTTENQRDPWVTHDAAGSAGGAHAANMDSELASIVSSLSALSSV
FT                   SAHQQHGQIGSFRRGSFHSNQGSDVESEMLFHTQTSPPIKRTTLSVGGMPLGGPSGVNN
FT                   RLSKMKNYSGSLAGGSVLQQQPIQGGFFERFGRSLAEGTREVELNLGSTSGRASRRESM
FT                   NAMDSLSRATTNSTFQGVAMEGRRTSVASDAMESLSENLNMQPEEPGNLNHRNIWKVAE
FT                   APVFRPQASENSGMEPAFPQPPAEALNQPYGFSYPNYWKMGAPMIPLAVPPSEQLKAGK
FT                   DFPEPSAAGGNVPVDPSSQPFPPFMFPNNPYLFFPPGATPPPPPHPFQPAASNPKDLPK
FT                   GPNAKTHGNPYLYNSRNHKPARGSPSAPFPPQPNPAAAANSSTPRGKGKYNVVRSPLLE
FT                   EFRNNSSGKEYRLPDIYGSALEFCKDQHGSRFIQQELVKATDTEKEVIFNEIRDEAINL
FT                   ADDVFGNYVIQKYFEHGLKSQKDVLFEKFTGKMEKLSLQMYACRVIQRALECIDLDQKV
FT                   ILVNELSGCVLKMIKDQNGNHVIQKAIERIPIEKLPFILGSLEGQIYHLSTHSYGCRVV
FT                   QRLLEYGTLEDQEKILADLDQFIPFLIQDQYGNYVIQHILKQGPETDDTHIGRTKQNIV
FT                   DIVCKNVVEYSKHKFASNVVEKTMVFGSPAQKKQFMEKVLPESAEHATRLEDNAPLILM
FT                   MRDQYANYVVQKLVGVAEGDDKKVTVIAIRSYLEKLNKINALGNRHLASVEKLAAIVEN
FT                   VQV"
     MSTTENQRDP WVTHDAAGSA GGAHAANMDS ELASIVSSLS ALSSVSAHQQ HGQIGSFRRG        60
     SFHSNQGSDV ESEMLFHTQT SPPIKRTTLS VGGMPLGGPS GVNNRLSKMK NYSGSLAGGS       120
     VLQQQPIQGG FFERFGRSLA EGTREVELNL GSTSGRASRR ESMNAMDSLS RATTNSTFQG       180
     VAMEGRRTSV ASDAMESLSE NLNMQPEEPG NLNHRNIWKV AEAPVFRPQA SENSGMEPAF       240
     PQPPAEALNQ PYGFSYPNYW KMGAPMIPLA VPPSEQLKAG KDFPEPSAAG GNVPVDPSSQ       300
     PFPPFMFPNN PYLFFPPGAT PPPPPHPFQP AASNPKDLPK GPNAKTHGNP YLYNSRNHKP       360
     ARGSPSAPFP PQPNPAAAAN SSTPRGKGKY NVVRSPLLEE FRNNSSGKEY RLPDIYGSAL       420
     EFCKDQHGSR FIQQELVKAT DTEKEVIFNE IRDEAINLAD DVFGNYVIQK YFEHGLKSQK       480
     DVLFEKFTGK MEKLSLQMYA CRVIQRALEC IDLDQKVILV NELSGCVLKM IKDQNGNHVI       540
     QKAIERIPIE KLPFILGSLE GQIYHLSTHS YGCRVVQRLL EYGTLEDQEK ILADLDQFIP       600
     FLIQDQYGNY VIQHILKQGP ETDDTHIGRT KQNIVDIVCK NVVEYSKHKF ASNVVEKTMV       660
     FGSPAQKKQF MEKVLPESAE HATRLEDNAP LILMMRDQYA NYVVQKLVGV AEGDDKKVTV       720
     IAIRSYLEKL NKINALGNRH LASVEKLAAI VENVQV                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page