(data stored in ACNUC8465 zone)

EMBL: CU928166.PE142

CU928166.PE142       Location/Qualifiers
FT   CDS             complement(288352..290331)
FT                   /locus_tag="KLTH0B03586g"
FT                   /old_locus_tag="KLTH-ORF15524"
FT                   /product="KLTH0B03586p"
FT                   /note="similar to uniprot|P41895 Saccharomyces cerevisiae
FT                   YGR186W TFG1 Largest subunit of the RNA Polymerase general
FT                   transcription factor IIF (TFIIF) interacts with Fcp1p
FT                   phosphatase and with TFIIB potentially phosphorylated by
FT                   Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03586g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21507"
FT                   /db_xref="GOA:C5DCJ6"
FT                   /db_xref="InterPro:IPR008851"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ6"
FT                   /protein_id="CAR21507.1"
FT                   /translation="MPNPLKSSNSASPFIKREQLRRDFLRSRLKKNGTPRPYVKKEDPE
FT                   AYDERTRQLLSGGQSHSGIKREEGSQYNEFPLRAVSHEQLENIRTHILKFQSKKKVDPQ
FT                   RDMHLPVRLHRKDTRNLQFQLTRAEIVQRQKEIAEYKMKADSERNGGEQSQAGSSATNL
FT                   QSDSNVASSAAQTPVETPGDTPADTPVKQESVKEEHGSSSMAIKKEGADLPATKLEEAG
FT                   VAEDPTKVGMVKYDGKEKPLETESKEDPFADVAPDGGGRFRRGNTKRKTRQLKLLDENA
FT                   KRLRFEEFYPWVLEDFDGLNTWVGSYEAGNSDSYVLLSVENDGSFTMIPADKVYKFTAR
FT                   NKYATLTIDEAEKRMEKNGKGIPRWLMKHLDDIGTTTTRYDRTQRKLRAVDARQGEEDD
FT                   RNDNSEVELDFDEEFADDEEAPIIDGDEKENKESEQRIKKEMLQANAMGLRDDDEEADD
FT                   DLFGEKKIDDEGERVMKALQKSDMAALYESDDESKSNPYLSESEGENTEEAKAKDENQE
FT                   NGKSSRKGSPKKKSSRGSPSGPRIYVKSIKDFQLVLRADKSVLRNFPEGNWNPHAKDEK
FT                   SRTPGAASSPSSPPIKIEDDIENPDLLTERDIIDVVTGRQMTLKQLIKELKEKVAKHPS
FT                   NKDRMKYLVKRLVRLNNGYLELNK"
     MPNPLKSSNS ASPFIKREQL RRDFLRSRLK KNGTPRPYVK KEDPEAYDER TRQLLSGGQS        60
     HSGIKREEGS QYNEFPLRAV SHEQLENIRT HILKFQSKKK VDPQRDMHLP VRLHRKDTRN       120
     LQFQLTRAEI VQRQKEIAEY KMKADSERNG GEQSQAGSSA TNLQSDSNVA SSAAQTPVET       180
     PGDTPADTPV KQESVKEEHG SSSMAIKKEG ADLPATKLEE AGVAEDPTKV GMVKYDGKEK       240
     PLETESKEDP FADVAPDGGG RFRRGNTKRK TRQLKLLDEN AKRLRFEEFY PWVLEDFDGL       300
     NTWVGSYEAG NSDSYVLLSV ENDGSFTMIP ADKVYKFTAR NKYATLTIDE AEKRMEKNGK       360
     GIPRWLMKHL DDIGTTTTRY DRTQRKLRAV DARQGEEDDR NDNSEVELDF DEEFADDEEA       420
     PIIDGDEKEN KESEQRIKKE MLQANAMGLR DDDEEADDDL FGEKKIDDEG ERVMKALQKS       480
     DMAALYESDD ESKSNPYLSE SEGENTEEAK AKDENQENGK SSRKGSPKKK SSRGSPSGPR       540
     IYVKSIKDFQ LVLRADKSVL RNFPEGNWNP HAKDEKSRTP GAASSPSSPP IKIEDDIENP       600
     DLLTERDIID VVTGRQMTLK QLIKELKEKV AKHPSNKDRM KYLVKRLVRL NNGYLELNK        659
//

If you have problems or comments...

PBIL Back to PBIL home page