(data stored in SCRATCH zone)

EMBL: CU928166.PE144

CU928166.PE144       Location/Qualifiers
FT   CDS             complement(292423..297858)
FT                   /locus_tag="KLTH0B03630g"
FT                   /old_locus_tag="KLTH-ORF15516"
FT                   /product="KLTH0B03630p"
FT                   /note="similar to uniprot|Q07963 Saccharomyces cerevisiae
FT                   YLR024C UBR2 Cytoplasmic ubiquitin-protein ligase (E3)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03630g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21509"
FT                   /db_xref="GOA:C5DCJ8"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039164"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ8"
FT                   /protein_id="CAR21509.1"
FT                   /translation="MTPEVNSLREFLVSLPRLASYKYNPSIEYLLWKTLDECVKDGLSS
FT                   VNWLEKEQFFASQNWENGAYQALRLPENWRDSFFSTAAKSGLNHAGSSCNRLCSPTETV
FT                   FYCFDCTRNPLYEICERCFDAQKHKGHRFTSRVVTRPEGRACHCGDPSGFNSGTNELLC
FT                   KNEANNQVRSPNYNYDANLTSIFEQILDYLIDTIIFLKELYEEPNKTVMSDGKGCPETT
FT                   STTCALQLYESDCSLHIKDLAYRISLLLNKPIEFGLMMVDKLQRDCSFITLFECADTKK
FT                   LAIIQDAFASENITLHVKATSNVFKEYLIDEIINWLYKLCLYSPSLTSKLSLRLALSGA
FT                   WNSGLLSTKHTPHDFSPFTSKIALLGGFVVPFEQRETFPWPKPWGFPFESDARHDPRIL
FT                   QVMHEYDKRLQETNSSGVTTRFTSILGSRLQTILVEEAALLPKIARFRILKIVSSIFTI
FT                   TDDSRKCIAAQYIDVYPNLLYNAVACDSFSQKVSLMSSLSQHIFQVPEIANMIISSGFI
FT                   ERIIQFAFTLMSFSPEELTECPPVPLYGDFKLPTDMIKNKRSVVCFKDIYLLMSTNTQP
FT                   EMLLTNDSITQCMIRCFSAFNNVLPLRRETAEHVEFENFEFSSYFFYFSSILVMVDGFI
FT                   RNICLLEDPHARGRVVRHFLKLSLSKEFELLGNAKSLMPGKLSTSCELKTSNGLRVIRE
FT                   KVCNTISSVIQFQVGIDCQSFFNPMSYFFKFVTLWSQCGRYEPLPYNFSDFFDIREVFG
FT                   DKIQMNWMCESALSTIVLLAQINVGFWVRNGSPIQHQARMYTRYSMREFTYFSDIFMLQ
FT                   LAMSIADPNEFMVTFLSRWGLKNWAEGIPIGDYPDAEITAGMVDQLLLLLIQLFSEIRS
FT                   LTMKSSVEGFEKTMQMEISHALCFKNSTHSEILNLIPEHVTKHPAFDLYLREMADYAPP
FT                   NGPVDAGIYTLKEKYFSLIDPYFIGFSPSKRFEAEKLIRKRLSIETQTDYNMSYIPARD
FT                   FASCLKETPYKNLYQICSTEIFGCFLKNTLDHINKFNYESMLTKATHLVHLCVVNDLLG
FT                   FTSIFWKEYGFSNSEYLYNSSIGSLLYSFLFKEEFVNEHGKIREIFQHFMKYAPHVNIE
FT                   GYLTEQTPSFNFEILKTPFKTTERKDEEYEKRKQLAKHKREKIMKRIAKQQQKFLANNH
FT                   ISLEDESGSLCKNRDQGENQFFPEMTCVFCKMHKVNDTFIYFAYLERNICEAEVELDWE
FT                   LSHARVSAIPKEGGRSHSNEAARDMDIVEMPQSLSSKISVFPVLRTCGHGSHVCCLTSH
FT                   MKSTRTVHNHITKNIPSSLGFSLMFCPLCSALTNCFLPRMCGDSSGSAPNPSEPIERND
FT                   PFESSLKNCNRSVAVLRELVQMDGVGESPIQVLNYIYRNTLRNTELATRLKRPHRETVK
FT                   ECSDFASHQQLLTLRLLSDLRRIYSQFSEPKEYVSPKEYSLFPPPFKYTPNQKSTKQEC
FT                   ELDLLNLADYRILNTDFGSKVCVKEFLLEFINKGLHQDFLAICGSIATKGSREVTACKH
FT                   QLQKKTSFTSSEEKHVFCILRSYLSNFSTADLTAVELATSITRGVLKDSMVIRLRRLFA
FT                   LLYFGGTPEFELKERIIDFGVLGDLLKGFDLPDFSELLQNYIDRDLQQMLKHVELTLKE
FT                   QGEEELIKNANALKIGCFKKNFLINLPQSYSEFMSNEDEFLQMRAKKQEIAICLFCGSR
FT                   VRVQNAVLLHNYSIGECTNHSLNVCRVNPIYGCFLLVRSNTVYLSYGHRGTFYQAPYLN
FT                   SHGETDDDYRNGAPVFLDRNRYLHLSQDVILNNMVPHLVFRLTENTLDLGGWESL"
     MTPEVNSLRE FLVSLPRLAS YKYNPSIEYL LWKTLDECVK DGLSSVNWLE KEQFFASQNW        60
     ENGAYQALRL PENWRDSFFS TAAKSGLNHA GSSCNRLCSP TETVFYCFDC TRNPLYEICE       120
     RCFDAQKHKG HRFTSRVVTR PEGRACHCGD PSGFNSGTNE LLCKNEANNQ VRSPNYNYDA       180
     NLTSIFEQIL DYLIDTIIFL KELYEEPNKT VMSDGKGCPE TTSTTCALQL YESDCSLHIK       240
     DLAYRISLLL NKPIEFGLMM VDKLQRDCSF ITLFECADTK KLAIIQDAFA SENITLHVKA       300
     TSNVFKEYLI DEIINWLYKL CLYSPSLTSK LSLRLALSGA WNSGLLSTKH TPHDFSPFTS       360
     KIALLGGFVV PFEQRETFPW PKPWGFPFES DARHDPRILQ VMHEYDKRLQ ETNSSGVTTR       420
     FTSILGSRLQ TILVEEAALL PKIARFRILK IVSSIFTITD DSRKCIAAQY IDVYPNLLYN       480
     AVACDSFSQK VSLMSSLSQH IFQVPEIANM IISSGFIERI IQFAFTLMSF SPEELTECPP       540
     VPLYGDFKLP TDMIKNKRSV VCFKDIYLLM STNTQPEMLL TNDSITQCMI RCFSAFNNVL       600
     PLRRETAEHV EFENFEFSSY FFYFSSILVM VDGFIRNICL LEDPHARGRV VRHFLKLSLS       660
     KEFELLGNAK SLMPGKLSTS CELKTSNGLR VIREKVCNTI SSVIQFQVGI DCQSFFNPMS       720
     YFFKFVTLWS QCGRYEPLPY NFSDFFDIRE VFGDKIQMNW MCESALSTIV LLAQINVGFW       780
     VRNGSPIQHQ ARMYTRYSMR EFTYFSDIFM LQLAMSIADP NEFMVTFLSR WGLKNWAEGI       840
     PIGDYPDAEI TAGMVDQLLL LLIQLFSEIR SLTMKSSVEG FEKTMQMEIS HALCFKNSTH       900
     SEILNLIPEH VTKHPAFDLY LREMADYAPP NGPVDAGIYT LKEKYFSLID PYFIGFSPSK       960
     RFEAEKLIRK RLSIETQTDY NMSYIPARDF ASCLKETPYK NLYQICSTEI FGCFLKNTLD      1020
     HINKFNYESM LTKATHLVHL CVVNDLLGFT SIFWKEYGFS NSEYLYNSSI GSLLYSFLFK      1080
     EEFVNEHGKI REIFQHFMKY APHVNIEGYL TEQTPSFNFE ILKTPFKTTE RKDEEYEKRK      1140
     QLAKHKREKI MKRIAKQQQK FLANNHISLE DESGSLCKNR DQGENQFFPE MTCVFCKMHK      1200
     VNDTFIYFAY LERNICEAEV ELDWELSHAR VSAIPKEGGR SHSNEAARDM DIVEMPQSLS      1260
     SKISVFPVLR TCGHGSHVCC LTSHMKSTRT VHNHITKNIP SSLGFSLMFC PLCSALTNCF      1320
     LPRMCGDSSG SAPNPSEPIE RNDPFESSLK NCNRSVAVLR ELVQMDGVGE SPIQVLNYIY      1380
     RNTLRNTELA TRLKRPHRET VKECSDFASH QQLLTLRLLS DLRRIYSQFS EPKEYVSPKE      1440
     YSLFPPPFKY TPNQKSTKQE CELDLLNLAD YRILNTDFGS KVCVKEFLLE FINKGLHQDF      1500
     LAICGSIATK GSREVTACKH QLQKKTSFTS SEEKHVFCIL RSYLSNFSTA DLTAVELATS      1560
     ITRGVLKDSM VIRLRRLFAL LYFGGTPEFE LKERIIDFGV LGDLLKGFDL PDFSELLQNY      1620
     IDRDLQQMLK HVELTLKEQG EEELIKNANA LKIGCFKKNF LINLPQSYSE FMSNEDEFLQ      1680
     MRAKKQEIAI CLFCGSRVRV QNAVLLHNYS IGECTNHSLN VCRVNPIYGC FLLVRSNTVY      1740
     LSYGHRGTFY QAPYLNSHGE TDDDYRNGAP VFLDRNRYLH LSQDVILNNM VPHLVFRLTE      1800
     NTLDLGGWES L                                                           1811
//

If you have problems or comments...

PBIL Back to PBIL home page