(data stored in SCRATCH zone)

EMBL: CU928166.PE145

CU928166.PE145       Location/Qualifiers
FT   CDS             298170..303941
FT                   /locus_tag="KLTH0B03652g"
FT                   /old_locus_tag="KLTH-ORF15512"
FT                   /product="KLTH0B03652p"
FT                   /note="similar to uniprot|P19812 Saccharomyces cerevisiae
FT                   YGR184C UBR1 Ubiquitin-protein ligase (E3) that interacts
FT                   with Rad6p/Ubc2p to ubiquitinate substrates of the N-end
FT                   rule pathway binds to the Rpn2p Rpt1p and Rpt6p proteins of
FT                   the 19S particle of the 26S proteasome"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03652g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21510"
FT                   /db_xref="GOA:C5DCJ9"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR039164"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCJ9"
FT                   /protein_id="CAR21510.1"
FT                   /translation="MIREGSADFQLHLRRTLQLIQNEPHFKKAKGPKDRAELDKLLKSF
FT                   IFRYLYFIVSNNGKFLPQLFTSVPHEKFPATLQEALDVDRASISRHDPFYVIDDSVANE
FT                   SHRHTGRNCGRKFQAGEPIYRCKECSFDDTCVLCIHCFNAKDHINHHVYTSICTHVNNG
FT                   ICDCGDVEAWNVPLNCKAETEDEGSESEGAFESPEMTYILELTLTEIFDHFLDVFNQNI
FT                   EPLPTMQRDITVKLRDMVQSEKSEEKEEFLQDLQYKNEDMQDLKKGLTEIEAPDYTVLV
FT                   YNDEYHNYSQATAALKQGVPDDKNTDKLTARIDGEGRAMLKCSKDISSVLSGFFAVRTN
FT                   GLSATLTAWSEYIQQEACKYIIAWVGHCLTIPNSSFQQGFRSAMGRVLCSGSERLPEAV
FT                   DVSLLVDKHFPAKHSEEDPYRYANLSVLDRENVVPFSHHKVLAEGETDHISLTLNKTEP
FT                   PSPKRYANSRLQLLLFFDNRYWKKLRKDIQDIVIPTMASSLEFKPIFCEQLVEIFNHMT
FT                   RSVAFMDREPQLTVLRESVVQLFTCPTNAYSIFQSGSFCDIMWSVIDIFTEFSKKDAGV
FT                   LVWQKVKKTNPTKSYSISFKQNLYSVETILSKVSDPNLLLRPKEFIAIVTLCKLFNGAW
FT                   KIKRKEGEHVLREDQNFIPYLEYTTSIYSIVQTVDKILENKRDEVDETLLLQAIKLLST
FT                   FLGHRTPSQTVYDSHEIIKFKVSKQPVAFMNPVHTLMSFLIEKVPLAKAFAALSGCNDF
FT                   LTISDFSLRAVVLCSQIDVGFWVRNGMSVLRQSSYYKNNPEMACYIRDVHLNQLTFLNE
FT                   KDDLVRLIYNILDRWELLEWFNGKEDFDKTVYEDKIVYILQQFIAFVYQLLTERQSFKI
FT                   FKSPEEKEYYQIKRAIMYGLYMEPLSYSSLLSAVPEYLTESTDQFDRALEDVSVYMGPK
FT                   GLMDNGVFKLKPELYKRIDPLQLPNMGNDFEHSASIIKARLAESGEDPKNTVLEPQLIS
FT                   PKFLDESAKNLGAFTRTKVFAKVIYNLLRVSIDLDEGTFLYALLHLVHSILKDDELVNG
FT                   KNSIPEVYISKPICNLLFIIIDIKSSVFSENVVAKADYLLESLIWKNPTSILESLVSSF
FT                   GEECVERYKARKLHQGINFEESEKGRKRRLAKERQEKILSKFSRQQHKFMKENQSEFGS
FT                   NDDDIEMADNGLSQAVEDYTCALCQDTSSVDAFVIPVYHENTPIFRNGDIRNVKEFGVE
FT                   WNRFQNNKDSATTYEEESVQNFREDGSKGSRKVFVSCNHYIHYKCFKRYAQKKRFSTNS
FT                   FICPLCQTFSNCVIPVAGYSPKPSESSIKELLQNSGAKSNIDHLHQTDPNEDFNGVFNM
FT                   FLEINKKNMYYDRHWATTPESQRPDVAYILAVHWANTISMLEVSARIADHPNDSLLQGK
FT                   EQKFRTLKNVLSSIAWLHKVLGRPSKEIIPYVNGEDTIWNQNQLFQFIVRRSLFSSEPI
FT                   TNVITGGLSVFSRQLLVDFLKGSTPNDVKMMREASANFGGIHDIDNETLDVLRDVCDIS
FT                   VSDEDTCRQLYSLAFASLIKNVLPTIRRCLILLKAINMLIMKSDEASLIVNGINLELVT
FT                   SSSTPEYINSVIGLITPFSSFNDLLRKSNSYVKSVTDPYLSNIPYEFTGIVKLMDLAPH
FT                   LNTYLTNSKEVKLREEHPARMRNAGNRLDFKICLTCGVKVHARNDRTELVRHLANHCFK
FT                   PFGLFLIPNLNEVTLILTNPRSSISISAPYLNSHGEAGRNAIQRGDLTALSLQRYEHLN
FT                   NVWLNSEVPGLISRVMGDEFRVLIVSNGVVLNFNRNVLRPRRANAEEPDGDSSSSEAED
FT                   DDLEGGEVRWEIRPEEFFEEAGIRFEGAGAIPGGDIRDFFQFINNLDTETDAFEEDEET
FT                   GGEAQGLANAFVPRFEFLPNFRNFNARNEDEPDDEDEDEVNHPVSDDIE"
     MIREGSADFQ LHLRRTLQLI QNEPHFKKAK GPKDRAELDK LLKSFIFRYL YFIVSNNGKF        60
     LPQLFTSVPH EKFPATLQEA LDVDRASISR HDPFYVIDDS VANESHRHTG RNCGRKFQAG       120
     EPIYRCKECS FDDTCVLCIH CFNAKDHINH HVYTSICTHV NNGICDCGDV EAWNVPLNCK       180
     AETEDEGSES EGAFESPEMT YILELTLTEI FDHFLDVFNQ NIEPLPTMQR DITVKLRDMV       240
     QSEKSEEKEE FLQDLQYKNE DMQDLKKGLT EIEAPDYTVL VYNDEYHNYS QATAALKQGV       300
     PDDKNTDKLT ARIDGEGRAM LKCSKDISSV LSGFFAVRTN GLSATLTAWS EYIQQEACKY       360
     IIAWVGHCLT IPNSSFQQGF RSAMGRVLCS GSERLPEAVD VSLLVDKHFP AKHSEEDPYR       420
     YANLSVLDRE NVVPFSHHKV LAEGETDHIS LTLNKTEPPS PKRYANSRLQ LLLFFDNRYW       480
     KKLRKDIQDI VIPTMASSLE FKPIFCEQLV EIFNHMTRSV AFMDREPQLT VLRESVVQLF       540
     TCPTNAYSIF QSGSFCDIMW SVIDIFTEFS KKDAGVLVWQ KVKKTNPTKS YSISFKQNLY       600
     SVETILSKVS DPNLLLRPKE FIAIVTLCKL FNGAWKIKRK EGEHVLREDQ NFIPYLEYTT       660
     SIYSIVQTVD KILENKRDEV DETLLLQAIK LLSTFLGHRT PSQTVYDSHE IIKFKVSKQP       720
     VAFMNPVHTL MSFLIEKVPL AKAFAALSGC NDFLTISDFS LRAVVLCSQI DVGFWVRNGM       780
     SVLRQSSYYK NNPEMACYIR DVHLNQLTFL NEKDDLVRLI YNILDRWELL EWFNGKEDFD       840
     KTVYEDKIVY ILQQFIAFVY QLLTERQSFK IFKSPEEKEY YQIKRAIMYG LYMEPLSYSS       900
     LLSAVPEYLT ESTDQFDRAL EDVSVYMGPK GLMDNGVFKL KPELYKRIDP LQLPNMGNDF       960
     EHSASIIKAR LAESGEDPKN TVLEPQLISP KFLDESAKNL GAFTRTKVFA KVIYNLLRVS      1020
     IDLDEGTFLY ALLHLVHSIL KDDELVNGKN SIPEVYISKP ICNLLFIIID IKSSVFSENV      1080
     VAKADYLLES LIWKNPTSIL ESLVSSFGEE CVERYKARKL HQGINFEESE KGRKRRLAKE      1140
     RQEKILSKFS RQQHKFMKEN QSEFGSNDDD IEMADNGLSQ AVEDYTCALC QDTSSVDAFV      1200
     IPVYHENTPI FRNGDIRNVK EFGVEWNRFQ NNKDSATTYE EESVQNFRED GSKGSRKVFV      1260
     SCNHYIHYKC FKRYAQKKRF STNSFICPLC QTFSNCVIPV AGYSPKPSES SIKELLQNSG      1320
     AKSNIDHLHQ TDPNEDFNGV FNMFLEINKK NMYYDRHWAT TPESQRPDVA YILAVHWANT      1380
     ISMLEVSARI ADHPNDSLLQ GKEQKFRTLK NVLSSIAWLH KVLGRPSKEI IPYVNGEDTI      1440
     WNQNQLFQFI VRRSLFSSEP ITNVITGGLS VFSRQLLVDF LKGSTPNDVK MMREASANFG      1500
     GIHDIDNETL DVLRDVCDIS VSDEDTCRQL YSLAFASLIK NVLPTIRRCL ILLKAINMLI      1560
     MKSDEASLIV NGINLELVTS SSTPEYINSV IGLITPFSSF NDLLRKSNSY VKSVTDPYLS      1620
     NIPYEFTGIV KLMDLAPHLN TYLTNSKEVK LREEHPARMR NAGNRLDFKI CLTCGVKVHA      1680
     RNDRTELVRH LANHCFKPFG LFLIPNLNEV TLILTNPRSS ISISAPYLNS HGEAGRNAIQ      1740
     RGDLTALSLQ RYEHLNNVWL NSEVPGLISR VMGDEFRVLI VSNGVVLNFN RNVLRPRRAN      1800
     AEEPDGDSSS SEAEDDDLEG GEVRWEIRPE EFFEEAGIRF EGAGAIPGGD IRDFFQFINN      1860
     LDTETDAFEE DEETGGEAQG LANAFVPRFE FLPNFRNFNA RNEDEPDDED EDEVNHPVSD      1920
     DIE                                                                    1923
//

If you have problems or comments...

PBIL Back to PBIL home page