(data stored in SCRATCH zone)

EMBL: CU928166.PE147

CU928166.PE147       Location/Qualifiers
FT   CDS             complement(305074..305463)
FT                   /locus_tag="KLTH0B03696g"
FT                   /old_locus_tag="KLTH-ORF15507"
FT                   /product="KLTH0B03696p"
FT                   /note="similar to uniprot|P53299 Saccharomyces cerevisiae
FT                   YGR181W TIM13 Translocase of the inner membrane
FT                   mitochondrial intermembrane space protein mediating import
FT                   and insertion of polytopic inner membrane proteins Subunit
FT                   of mitochondrial protein import machinery"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03696g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21512"
FT                   /db_xref="GOA:C5DCK1"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="InterPro:IPR035427"
FT                   /db_xref="InterPro:IPR039238"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK1"
FT                   /protein_id="CAR21512.1"
FT                   /translation="MELPLEAIPLYSQRTLSRTNDCSTFRMALSSIFGGASPSQQRTTT
FT                   SSSKASSVKEQLKTQIAQELAVANASELVNKVTENCFEKCLTNPYSNAEEGCVDQCLAK
FT                   YMRSWNVVSKAYVARIQQASTSGEI"
     MELPLEAIPL YSQRTLSRTN DCSTFRMALS SIFGGASPSQ QRTTTSSSKA SSVKEQLKTQ        60
     IAQELAVANA SELVNKVTEN CFEKCLTNPY SNAEEGCVDQ CLAKYMRSWN VVSKAYVARI       120
     QQASTSGEI                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page