(data stored in ACNUC8465 zone)

EMBL: CU928166.PE148

CU928166.PE148       Location/Qualifiers
FT   CDS             join(306104..306125,306192..306745)
FT                   /locus_tag="KLTH0B03740g"
FT                   /old_locus_tag="Klth0B.mRNA.237.p"
FT                   /product="KLTH0B03740p"
FT                   /note="highly similar to uniprot|P47064 Saccharomyces
FT                   cerevisiae YJL024C APS3 Small subunit of the clathrin-
FT                   associated adaptor complex AP-3 which is involved in
FT                   vacuolar protein sorting related to the sigma subunit of
FT                   the mammalian clathrin AP-3 complex suppressor of loss of
FT                   casein kinase 1 function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03740g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21513"
FT                   /db_xref="GOA:C5DCK2"
FT                   /db_xref="InterPro:IPR000804"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR016635"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR027155"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK2"
FT                   /protein_id="CAR21513.1"
FT                   /translation="MIHAVLIFNKKAQPRLVKFYTPVELPQQKLLIQQVYELISQRNSE
FT                   FQSSFLTTPPSLVHAGSDELSDDQDIQVIYKNYATLYFTFIVDDQESELAILDLIQTFV
FT                   ESLDRCFAEVNELDLIFNWQTLESVLEEIVQGGMVIETSVAKIVSAVDQLNRSSSGDNR
FT                   AGRFAGAGLGNALQSIVQAGFSGWGANQ"
     MIHAVLIFNK KAQPRLVKFY TPVELPQQKL LIQQVYELIS QRNSEFQSSF LTTPPSLVHA        60
     GSDELSDDQD IQVIYKNYAT LYFTFIVDDQ ESELAILDLI QTFVESLDRC FAEVNELDLI       120
     FNWQTLESVL EEIVQGGMVI ETSVAKIVSA VDQLNRSSSG DNRAGRFAGA GLGNALQSIV       180
     QAGFSGWGAN Q                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page