(data stored in ACNUC8465 zone)

EMBL: CU928166.PE152

CU928166.PE152       Location/Qualifiers
FT   CDS             complement(311528..313060)
FT                   /locus_tag="KLTH0B03828g"
FT                   /old_locus_tag="KLTH-ORF15495"
FT                   /product="KLTH0B03828p"
FT                   /note="similar to uniprot|P40992 Saccharomyces cerevisiae
FT                   YJL025W RRN7 involved in the transcription of 35S rRNA
FT                   genes by RNA polymerase I member of yeast Pol I core factor
FT                   (CF) also composed of Rrn11p Rrn6p and TATA- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03828g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21517"
FT                   /db_xref="GOA:C5DCK6"
FT                   /db_xref="InterPro:IPR021752"
FT                   /db_xref="InterPro:IPR033599"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK6"
FT                   /protein_id="CAR21517.1"
FT                   /translation="MSTFFRGPVCGTDNCRSRLWRIIDGRRTCQYGHVMEGDVEFNDDE
FT                   DDINSMGVITRRLNLTTNATGSFRSSMNSQSQLSQKEDANQKVYGAEGERLFLRCFQYI
FT                   LKLQCTWLIEHQNFPPVFTDVVKLMWMRFIRSLEIADQRSATGDDNGGTSMQVPGKKPR
FT                   LSLLSSICLLYMANTHLRMPVHSCDYIRWICSMKLVYFKANLHLPALWRKQLPNYYHQV
FT                   LEGGKTPSEGQFFHKLAHMCFAVQLSSCFSTYVSYEALTLKLLFAVKLPPQILFDVKEL
FT                   IRISGESDSSFCLYENHRERVERLYQCSDLRIAAYFILAVRYKILQDDPFFVNYCLAWL
FT                   EIEGSEDSPAATEDLVTKLSHDAASLHQNNHRWSDQQTTDYLDWMEQHFLPASTKTQTE
FT                   AQTIDHRIASKKLYSMFPLEKAPTGSAEDRATRPSYVDKTQEAYLEISDALAHGVRVPR
FT                   QKQTPMLAQLAEAKLLREISYRFAVSQPQLRECLGHLQSRICKTRNSMNCAS"
     MSTFFRGPVC GTDNCRSRLW RIIDGRRTCQ YGHVMEGDVE FNDDEDDINS MGVITRRLNL        60
     TTNATGSFRS SMNSQSQLSQ KEDANQKVYG AEGERLFLRC FQYILKLQCT WLIEHQNFPP       120
     VFTDVVKLMW MRFIRSLEIA DQRSATGDDN GGTSMQVPGK KPRLSLLSSI CLLYMANTHL       180
     RMPVHSCDYI RWICSMKLVY FKANLHLPAL WRKQLPNYYH QVLEGGKTPS EGQFFHKLAH       240
     MCFAVQLSSC FSTYVSYEAL TLKLLFAVKL PPQILFDVKE LIRISGESDS SFCLYENHRE       300
     RVERLYQCSD LRIAAYFILA VRYKILQDDP FFVNYCLAWL EIEGSEDSPA ATEDLVTKLS       360
     HDAASLHQNN HRWSDQQTTD YLDWMEQHFL PASTKTQTEA QTIDHRIASK KLYSMFPLEK       420
     APTGSAEDRA TRPSYVDKTQ EAYLEISDAL AHGVRVPRQK QTPMLAQLAE AKLLREISYR       480
     FAVSQPQLRE CLGHLQSRIC KTRNSMNCAS                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page