(data stored in ACNUC8465 zone)

EMBL: CU928166.PE154

CU928166.PE154       Location/Qualifiers
FT   CDS             complement(315749..316837)
FT                   /locus_tag="KLTH0B03872g"
FT                   /old_locus_tag="KLTH-ORF15487"
FT                   /product="KLTH0B03872p"
FT                   /note="weakly similar to uniprot|P53298 Saccharomyces
FT                   cerevisiae YGR179C OKP1 Outer kinetochore protein required
FT                   for accurate mitotic chromosome segregation forms a complex
FT                   with Mcm21p and Okp1p that binds to centromeres via the
FT                   CBF3 complex"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03872g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21519"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCK8"
FT                   /protein_id="CAR21519.1"
FT                   /translation="MSLQKPLLDAIVESDHEGSVMVDHATDDSTSEVDESFVQLDGDEF
FT                   RLDQEARRKGPVGKKLFVEEDSIAESPLRNGLLGPSLIASSPQKSDLESPSKRVQFKHH
FT                   IDSASEEEPISEQPIDQWNFKDLIGDRFRERLPETDLKAWQRPSKRLLNSITDILENNI
FT                   DLALEATFEKYEAECERLAIGRSVKHIRRDKERMLHKTIGKIERQLQSSKFPSRVKDRD
FT                   FDIEYIYAKRTFIQNSFSQELEHTDSVEHQVLREQKALEDLKHVQAKLSNRALRQTKLL
FT                   TEQLSHNLHPALSKAMVNSFGLIGDNAINKERYKKDVDELNLKLADPSAGVTHSLLHKY
FT                   LPSLKNYEKTAEKLQGSLPNLN"
     MSLQKPLLDA IVESDHEGSV MVDHATDDST SEVDESFVQL DGDEFRLDQE ARRKGPVGKK        60
     LFVEEDSIAE SPLRNGLLGP SLIASSPQKS DLESPSKRVQ FKHHIDSASE EEPISEQPID       120
     QWNFKDLIGD RFRERLPETD LKAWQRPSKR LLNSITDILE NNIDLALEAT FEKYEAECER       180
     LAIGRSVKHI RRDKERMLHK TIGKIERQLQ SSKFPSRVKD RDFDIEYIYA KRTFIQNSFS       240
     QELEHTDSVE HQVLREQKAL EDLKHVQAKL SNRALRQTKL LTEQLSHNLH PALSKAMVNS       300
     FGLIGDNAIN KERYKKDVDE LNLKLADPSA GVTHSLLHKY LPSLKNYEKT AEKLQGSLPN       360
     LN                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page