(data stored in SCRATCH zone)

EMBL: CU928166.PE156

CU928166.PE156       Location/Qualifiers
FT   CDS             320151..321128
FT                   /locus_tag="KLTH0B03916g"
FT                   /old_locus_tag="KLTH-ORF15480"
FT                   /product="KLTH0B03916p"
FT                   /note="highly similar to uniprot|P32318 Saccharomyces
FT                   cerevisiae YGR144W THI4 Protein required for thiamine
FT                   biosynthesis and for mitochondrial genome stability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03916g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21521"
FT                   /db_xref="GOA:C5DCL0"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="InterPro:IPR027495"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL0"
FT                   /protein_id="CAR21521.1"
FT                   /translation="MSTTTTNTETAQLQVSAGTIRHALSDVVKQEDWSDFQFAPIREST
FT                   VSRAMTSRYFQDMDKFAVSDVVIVGAGSSGLSAAYVIAKNRPDLKVACVESNVAPGGGA
FT                   WLGGQLFSAMIMRKPAHLFLDELELPYEDEGDYVVVKHAALFTSTVLSKVLLFPNFKLF
FT                   NATAVEDLVTRPADDNTGGVSVAGVVTNWTLVSMAHDLQSCMDPNVIELSGYQNDGTRD
FT                   PSKKHGVILSTTGHDGPFGAFSAKRIVSIDKNKKLGGMKGLDMNRAEAGVVKGAGAYSG
FT                   VANMYFAGMEVAELEGCNRMGPTFGAMAVSGIKAAEEILRHFAE"
     MSTTTTNTET AQLQVSAGTI RHALSDVVKQ EDWSDFQFAP IRESTVSRAM TSRYFQDMDK        60
     FAVSDVVIVG AGSSGLSAAY VIAKNRPDLK VACVESNVAP GGGAWLGGQL FSAMIMRKPA       120
     HLFLDELELP YEDEGDYVVV KHAALFTSTV LSKVLLFPNF KLFNATAVED LVTRPADDNT       180
     GGVSVAGVVT NWTLVSMAHD LQSCMDPNVI ELSGYQNDGT RDPSKKHGVI LSTTGHDGPF       240
     GAFSAKRIVS IDKNKKLGGM KGLDMNRAEA GVVKGAGAYS GVANMYFAGM EVAELEGCNR       300
     MGPTFGAMAV SGIKAAEEIL RHFAE                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page