(data stored in SCRATCH zone)

EMBL: CU928166.PE157

CU928166.PE157       Location/Qualifiers
FT   CDS             complement(321488..322699)
FT                   /locus_tag="KLTH0B03938g"
FT                   /old_locus_tag="KLTH-ORF15478"
FT                   /product="KLTH0B03938p"
FT                   /note="highly similar to uniprot|P09938 Saccharomyces
FT                   cerevisiae YJL026W RNR2 Ribonucleotide-diphosphate
FT                   reductase (RNR) small subunit the RNR complex catalyzes the
FT                   rate-limiting step in dNTP synthesis and is regulated by
FT                   DNA replication and DNA damage checkpoint pathways via
FT                   localization of the small subunits"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B03938g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21522"
FT                   /db_xref="GOA:C5DCL1"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL1"
FT                   /protein_id="CAR21522.1"
FT                   /translation="MVNAKETPSKAAASALSDLELKDSKNNLSGRLGAVPESAGEDAAA
FT                   LELKLSQAAEQHRQFLKSHHVHRHQLKEMEKEEPLLMENKRRFVLFPIKYHEIWQAYKR
FT                   AEASFWTAEEIDLSKDLHDWNNRMNENERFFISRVIAFFAASDGIVNENLVENFSAEVQ
FT                   SPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKESDFLFNAIETIPQIKEKAEWAIRW
FT                   IQDEDALFAERLVAFAAVEGVFFSGSFAAIFWLKKKGLMPGLTFSNELICRDEGLHTDF
FT                   ACLLFAHLKNKPDPAIIERIITEAVEIEQRYFRDALPVSLLGMNADLMNQYVEFVADRL
FT                   LVALGNQKFYNVTNPFDFMENISLAGKTNFFEKRVSDYQKAGVMAKSTKAETEGGEFAF
FT                   DEDF"
     MVNAKETPSK AAASALSDLE LKDSKNNLSG RLGAVPESAG EDAAALELKL SQAAEQHRQF        60
     LKSHHVHRHQ LKEMEKEEPL LMENKRRFVL FPIKYHEIWQ AYKRAEASFW TAEEIDLSKD       120
     LHDWNNRMNE NERFFISRVI AFFAASDGIV NENLVENFSA EVQSPEAKCF YGFQIMMENI       180
     HSETYSLLID TYIKDPKESD FLFNAIETIP QIKEKAEWAI RWIQDEDALF AERLVAFAAV       240
     EGVFFSGSFA AIFWLKKKGL MPGLTFSNEL ICRDEGLHTD FACLLFAHLK NKPDPAIIER       300
     IITEAVEIEQ RYFRDALPVS LLGMNADLMN QYVEFVADRL LVALGNQKFY NVTNPFDFME       360
     NISLAGKTNF FEKRVSDYQK AGVMAKSTKA ETEGGEFAFD EDF                         403
//

If you have problems or comments...

PBIL Back to PBIL home page