(data stored in ACNUC8465 zone)

EMBL: CU928166.PE159

CU928166.PE159       Location/Qualifiers
FT   CDS             complement(324153..324614)
FT                   /locus_tag="KLTH0B04004g"
FT                   /old_locus_tag="KLTH-ORF15465"
FT                   /product="KLTH0B04004p"
FT                   /note="highly similar to uniprot|P36010 Saccharomyces
FT                   cerevisiae YKL067W YNK1 Nucleoside diphosphate kinase
FT                   catalyzes the phosphorylation of nucleoside diphosphates
FT                   into the corresponding triphosphates for nucleic acid
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04004g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21524"
FT                   /db_xref="GOA:C5DCL3"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL3"
FT                   /protein_id="CAR21524.1"
FT                   /translation="MSSQTERTFIAIKPDGVQRGLVAKILARFEDRGFKLVAVKLLRPS
FT                   QELLRQHYAEHVDKPFFPKMSAFMSSGPVLATVWEGKDAVRQGRVILGATNPLNSAPGT
FT                   IRGDFAIDMGRNVCHGSDSVESAQREIALWFQPEELVEWTPAQAAWVYE"
     MSSQTERTFI AIKPDGVQRG LVAKILARFE DRGFKLVAVK LLRPSQELLR QHYAEHVDKP        60
     FFPKMSAFMS SGPVLATVWE GKDAVRQGRV ILGATNPLNS APGTIRGDFA IDMGRNVCHG       120
     SDSVESAQRE IALWFQPEEL VEWTPAQAAW VYE                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page