(data stored in SCRATCH zone)

EMBL: CU928166.PE161

CU928166.PE161       Location/Qualifiers
FT   CDS             326073..327434
FT                   /locus_tag="KLTH0B04048g"
FT                   /old_locus_tag="KLTH-ORF15456"
FT                   /product="KLTH0B04048p"
FT                   /note="weakly similar to uniprot|Q04213 Saccharomyces
FT                   cerevisiae YMR044W IOC4 Member of a complex (Isw1b) with
FT                   Isw1p and Ioc2p that exhibits nucleosome-stimulated ATPase
FT                   activity and acts within coding regions to coordinate
FT                   transcription elongation with termination and processing
FT                   contains a PWWP motif"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04048g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21526"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCL5"
FT                   /protein_id="CAR21526.1"
FT                   /translation="MPPKKHIYQPTDIVLAKVKGFPAWPALVVPEEIAPANVLEERPGR
FT                   PTVEELDDEQNPENFIPYSDTLRFRKNFKPHNSYLLKFLCDDSYIWLKPTDFKPLTPEQ
FT                   CDAWLSKSSKKSKKLIPAFELARRGTHGPDAIDVLEFVQYGSSGKPAEEEYVEPAAEQE
FT                   EEDEEEGEAEPAAEQEPLDEDADADADQESPLSELPSSGSDSDFEDDTTHRRRPVRGTR
FT                   QSKRTRARTNEREPELQELQDEPAPKKARSHKKKQPQKVEVEKYKFEDDEDWSIVGLGP
FT                   QDPPVSKFNSLVNKLSQKRNLEVHNEFKADLRDRLGIVNKMLVGIVFDTKRKSVTEDLH
FT                   VLLDELEQCSALRGTQDELITVFLSDHELVINISALFNLKQDQLREAGLYDKLQQWYSQ
FT                   IYGGQFVADPVAWSLDKINDVHAPPQEDAPSAADAASNGAGPAAPPVTTSDANM"
     MPPKKHIYQP TDIVLAKVKG FPAWPALVVP EEIAPANVLE ERPGRPTVEE LDDEQNPENF        60
     IPYSDTLRFR KNFKPHNSYL LKFLCDDSYI WLKPTDFKPL TPEQCDAWLS KSSKKSKKLI       120
     PAFELARRGT HGPDAIDVLE FVQYGSSGKP AEEEYVEPAA EQEEEDEEEG EAEPAAEQEP       180
     LDEDADADAD QESPLSELPS SGSDSDFEDD TTHRRRPVRG TRQSKRTRAR TNEREPELQE       240
     LQDEPAPKKA RSHKKKQPQK VEVEKYKFED DEDWSIVGLG PQDPPVSKFN SLVNKLSQKR       300
     NLEVHNEFKA DLRDRLGIVN KMLVGIVFDT KRKSVTEDLH VLLDELEQCS ALRGTQDELI       360
     TVFLSDHELV INISALFNLK QDQLREAGLY DKLQQWYSQI YGGQFVADPV AWSLDKINDV       420
     HAPPQEDAPS AADAASNGAG PAAPPVTTSD ANM                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page