(data stored in ACNUC8465 zone)

EMBL: CU928166.PE167

CU928166.PE167       Location/Qualifiers
FT   CDS             340239..340847
FT                   /locus_tag="KLTH0B04224g"
FT                   /old_locus_tag="KLTH-ORF15421"
FT                   /product="KLTH0B04224p"
FT                   /note="similar to uniprot|P46671 Saccharomyces cerevisiae
FT                   YMR052W FAR3 Protein involved in G1 cell cycle arrest in
FT                   response to pheromone in a pathway different from the
FT                   Far1p-dependent pathway interacts with Far7p Far8p Far9p
FT                   Far10p and Far11p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04224g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21532"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCM1"
FT                   /protein_id="CAR21532.1"
FT                   /translation="MENSADSFEYLLHLTKGLSTECRSTRQGTERIEHLVKRLAKLTQT
FT                   SYEELSKNPGPQVLQKYRELGRESERDRLERENYALIYQIERQEYVCRRIWSLIDQVED
FT                   LLESIKKFVVEQQGHRLRTENEFLETVVHSRMANLQVNTEDLVEAKNASRTKLDLLTRE
FT                   LKDLCKQIDWNKMSDSEDATLLSRKVSEVESKYKLKLKS"
     MENSADSFEY LLHLTKGLST ECRSTRQGTE RIEHLVKRLA KLTQTSYEEL SKNPGPQVLQ        60
     KYRELGRESE RDRLERENYA LIYQIERQEY VCRRIWSLID QVEDLLESIK KFVVEQQGHR       120
     LRTENEFLET VVHSRMANLQ VNTEDLVEAK NASRTKLDLL TRELKDLCKQ IDWNKMSDSE       180
     DATLLSRKVS EVESKYKLKL KS                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page