(data stored in ACNUC8465 zone)

EMBL: CU928166.PE181

CU928166.PE181       Location/Qualifiers
FT   CDS             367438..367770
FT                   /locus_tag="KLTH0B04532g"
FT                   /old_locus_tag="KLTH-ORF15368"
FT                   /product="KLTH0B04532p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04532g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21546"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCN5"
FT                   /protein_id="CAR21546.1"
FT                   /translation="MDAAGRLCSLLSCPTRAAPAMKRSSPDDCVYVASKKCQMYTACSG
FT                   TDAFRAMLRTARRASRPAAPAAFEQECYYCSSRAPTAVCGACHESVCTVCSAGGTATCL
FT                   NCRVAC"
     MDAAGRLCSL LSCPTRAAPA MKRSSPDDCV YVASKKCQMY TACSGTDAFR AMLRTARRAS        60
     RPAAPAAFEQ ECYYCSSRAP TAVCGACHES VCTVCSAGGT ATCLNCRVAC                  110
//

If you have problems or comments...

PBIL Back to PBIL home page