(data stored in SCRATCH zone)

EMBL: CU928166.PE183

CU928166.PE183       Location/Qualifiers
FT   CDS             370504..373431
FT                   /locus_tag="KLTH0B04576g"
FT                   /old_locus_tag="KLTH-ORF15355"
FT                   /product="KLTH0B04576p"
FT                   /note="highly similar to uniprot|P16861 Saccharomyces
FT                   cerevisiae YGR240C PFK1 Alpha subunit of heterooctameric
FT                   phosphofructokinase involved in glycolysis indispensable
FT                   for anaerobic growth activated by fructose-2 6-
FT                   bisphosphate and AMP mutation inhibits glucose induction of
FT                   cell cycle-related genes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04576g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21548"
FT                   /db_xref="GOA:C5DCN7"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR009161"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="InterPro:IPR040712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCN7"
FT                   /protein_id="CAR21548.1"
FT                   /translation="MTQETVYGVAFRSVATADESAYRSAIKFYHKLGFSTVKTYDKFRG
FT                   NKEAATSGTAQGSVKETWLESFKLSEVDSNGFRIPQQEATNHEQSDGALLKIRLVAHQP
FT                   LEAKNSRVTYYSASIDEVSKAFPDAKKLENGEYALNDPLGYELRLSGYVRAGDKKTVDK
FT                   EFFLDESKTPADYLKGQNLSPNQIPGATSTGIKKKIAVMTSGGDSPGMNSAVRAVVRAG
FT                   IYYGCDVFAVYEGYEGLLKGGDLLKKMEWKDVRGWLSEGGTLIGTARCMEFRERWGRKQ
FT                   AAGNLISEGIDALVVCGGDGSLTGADLFRSEWPSLVEELVKDGKFTEKQVEPYRNLKIV
FT                   GLVGSIDNDMSGTDSTIGAYSALERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLALM
FT                   AGIATGADYIFVPERAAPAGKWQEELKKVCQAHREKGRRNNTVIVAEGALDNNLKPITS
FT                   EQVKDALVELGLDTKITTLGHVQRGGTAVAHDRWLATLQGVDAVKAVLEMTPETPSPLI
FT                   GILENKIIRMPLMESVKLTKSVAEAIENKDFDKAISLRDTEFIELYENFISTTVKDDGS
FT                   ERLPEDQRLNIAIVHVGAPSAALNAATRAATLYCLSRGHKPSAILNGFSGLIQTGEIKE
FT                   LSWIDVENWHNLGGSEIGTNRSVASEDMGSIAYHFQKNKFDGVIILGGFEGFKSLKELR
FT                   DARAQYPIFNIPMVLIPSTVSNNVPGTEYSLGVDTCLNTLVNYTDAIKQSASATRRRVF
FT                   VVEVQGGHSGYIASFTGLVTGAVSVYTPEDQIDLKSIREDLALLKENFRHDQGETRNGK
FT                   LVIRNEQASSIYTTDLLADIIAEASSGKFGVRTAIPGHVQQGGVPSSKDRVTGSRYAVK
FT                   CVKFIEAWNRKNSDEQNEDFKILRFKYVNGVKEYTIQDEDASAAIIAVNGSHISFKPIA
FT                   RLWEEETNVELRKGQEVHWEEFNKIGDILSGRLNLRKEVDAGKSA"
     MTQETVYGVA FRSVATADES AYRSAIKFYH KLGFSTVKTY DKFRGNKEAA TSGTAQGSVK        60
     ETWLESFKLS EVDSNGFRIP QQEATNHEQS DGALLKIRLV AHQPLEAKNS RVTYYSASID       120
     EVSKAFPDAK KLENGEYALN DPLGYELRLS GYVRAGDKKT VDKEFFLDES KTPADYLKGQ       180
     NLSPNQIPGA TSTGIKKKIA VMTSGGDSPG MNSAVRAVVR AGIYYGCDVF AVYEGYEGLL       240
     KGGDLLKKME WKDVRGWLSE GGTLIGTARC MEFRERWGRK QAAGNLISEG IDALVVCGGD       300
     GSLTGADLFR SEWPSLVEEL VKDGKFTEKQ VEPYRNLKIV GLVGSIDNDM SGTDSTIGAY       360
     SALERICEMV DYIDATAKSH SRAFVVEVMG RHCGWLALMA GIATGADYIF VPERAAPAGK       420
     WQEELKKVCQ AHREKGRRNN TVIVAEGALD NNLKPITSEQ VKDALVELGL DTKITTLGHV       480
     QRGGTAVAHD RWLATLQGVD AVKAVLEMTP ETPSPLIGIL ENKIIRMPLM ESVKLTKSVA       540
     EAIENKDFDK AISLRDTEFI ELYENFISTT VKDDGSERLP EDQRLNIAIV HVGAPSAALN       600
     AATRAATLYC LSRGHKPSAI LNGFSGLIQT GEIKELSWID VENWHNLGGS EIGTNRSVAS       660
     EDMGSIAYHF QKNKFDGVII LGGFEGFKSL KELRDARAQY PIFNIPMVLI PSTVSNNVPG       720
     TEYSLGVDTC LNTLVNYTDA IKQSASATRR RVFVVEVQGG HSGYIASFTG LVTGAVSVYT       780
     PEDQIDLKSI REDLALLKEN FRHDQGETRN GKLVIRNEQA SSIYTTDLLA DIIAEASSGK       840
     FGVRTAIPGH VQQGGVPSSK DRVTGSRYAV KCVKFIEAWN RKNSDEQNED FKILRFKYVN       900
     GVKEYTIQDE DASAAIIAVN GSHISFKPIA RLWEEETNVE LRKGQEVHWE EFNKIGDILS       960
     GRLNLRKEVD AGKSA                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page