(data stored in ACNUC8465 zone)

EMBL: CU928166.PE185

CU928166.PE185       Location/Qualifiers
FT   CDS             complement(375653..377353)
FT                   /locus_tag="KLTH0B04620g"
FT                   /old_locus_tag="KLTH-ORF15348"
FT                   /product="KLTH0B04620p"
FT                   /note="weakly similar to uniprot|P32493 Saccharomyces
FT                   cerevisiae YMR064W AEP1 Protein required for expression of
FT                   the mitochondrial OLI1 gene encoding subunit 9 of F1-F0 ATP
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04620g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21550"
FT                   /db_xref="GOA:C5DCN9"
FT                   /db_xref="InterPro:IPR031467"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5DCN9"
FT                   /protein_id="CAR21550.1"
FT                   /translation="MGSRIFSPRRLYSALSELKTETVIPKNPNKRTRDGSFRKFKRVAP
FT                   AIGDSMHPFYSPNIMERAILCASEIKPELLDGQPIVPAVIKQLKTLEPALVNTRWQPQS
FT                   TQGLNDWLEPFRKMRRKSSPLKLIENHEIDNVIRPSRIDSGRIPELRKFALMFEKEDAG
FT                   ILSASTIGSLIDRLAADQEKAVFSEEVFLYILQHYCKSSQGIASVVDSITEFLHKDIDD
FT                   LKTAETLLAHVLMALRRNSIPLTPRATSAILKLIDSVSTRFHRPFCVVDFSPAVVQMTT
FT                   EFYVDSGFLKESKVLFTDMVNKERCPSAQLVEKYLGLIESVCGISTSDNDFLKKFVYIS
FT                   NFRPIFQTTMTPRITEFLVSYCRHFDEILSLLVLVDHSKVKKQIWDLVLPQMIRRVSLL
FT                   TKDSAKNCCHLTVLYQKASRFYGMPLSTKVNKAFIIQYAVNGNFAMVARLLSIIDSNAF
FT                   PSFYASVLAAYDQSSAFSMEVPSSGAALKNKHQFMTSMIIPHYTEISFVGRQLALKHAD
FT                   TEELLEQVLKAEIAIKGRGGKSLLPQVSLKAQDCKSNYIITEAEKCLQH"
     MGSRIFSPRR LYSALSELKT ETVIPKNPNK RTRDGSFRKF KRVAPAIGDS MHPFYSPNIM        60
     ERAILCASEI KPELLDGQPI VPAVIKQLKT LEPALVNTRW QPQSTQGLND WLEPFRKMRR       120
     KSSPLKLIEN HEIDNVIRPS RIDSGRIPEL RKFALMFEKE DAGILSASTI GSLIDRLAAD       180
     QEKAVFSEEV FLYILQHYCK SSQGIASVVD SITEFLHKDI DDLKTAETLL AHVLMALRRN       240
     SIPLTPRATS AILKLIDSVS TRFHRPFCVV DFSPAVVQMT TEFYVDSGFL KESKVLFTDM       300
     VNKERCPSAQ LVEKYLGLIE SVCGISTSDN DFLKKFVYIS NFRPIFQTTM TPRITEFLVS       360
     YCRHFDEILS LLVLVDHSKV KKQIWDLVLP QMIRRVSLLT KDSAKNCCHL TVLYQKASRF       420
     YGMPLSTKVN KAFIIQYAVN GNFAMVARLL SIIDSNAFPS FYASVLAAYD QSSAFSMEVP       480
     SSGAALKNKH QFMTSMIIPH YTEISFVGRQ LALKHADTEE LLEQVLKAEI AIKGRGGKSL       540
     LPQVSLKAQD CKSNYIITEA EKCLQH                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page