(data stored in ACNUC8465 zone)

EMBL: CU928166.PE191

CU928166.PE191       Location/Qualifiers
FT   CDS             391353..392171
FT                   /locus_tag="KLTH0B04752g"
FT                   /old_locus_tag="KLTH-ORF15327"
FT                   /product="KLTH0B04752p"
FT                   /note="similar to uniprot|Q05775 Saccharomyces cerevisiae
FT                   YLR192C HCR1 Dual function protein involved in translation
FT                   initiation as a substoichiometric component of eukaryotic
FT                   translation initiation factor 3 (eIF3) and required for
FT                   processing of 20S pre-rRNA binds to eIF3 subunits Rpg1p and
FT                   Prt1p and 18S rRNA"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04752g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21556"
FT                   /db_xref="GOA:C5DCP5"
FT                   /db_xref="InterPro:IPR013906"
FT                   /db_xref="InterPro:IPR023194"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP5"
FT                   /protein_id="CAR21556.1"
FT                   /translation="MSWDDEDFDLPSSAKNEPVLASWDDEFAETNDDDDAVLESWDAEP
FT                   AAASAKKPTAPAKKPAAKKDKKDAAASKPLLEIDTLDESTRRELLRKAEVDSDLNNAAD
FT                   LFGGLGVAEEHPRARALRKQQEEEALTRPAALTKDTPLDTHPLFQAESKKEYQELRKAL
FT                   AAAITPLNERSALNYSSGLAIDLIRDVANPMSTESIRQTIATLNVLMKDKERQERLARL
FT                   AKVKGGTATGGAGKKKAKATRANLGGAFKKDQEFDLETPAFDDFGEDDFM"
     MSWDDEDFDL PSSAKNEPVL ASWDDEFAET NDDDDAVLES WDAEPAAASA KKPTAPAKKP        60
     AAKKDKKDAA ASKPLLEIDT LDESTRRELL RKAEVDSDLN NAADLFGGLG VAEEHPRARA       120
     LRKQQEEEAL TRPAALTKDT PLDTHPLFQA ESKKEYQELR KALAAAITPL NERSALNYSS       180
     GLAIDLIRDV ANPMSTESIR QTIATLNVLM KDKERQERLA RLAKVKGGTA TGGAGKKKAK       240
     ATRANLGGAF KKDQEFDLET PAFDDFGEDD FM                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page