(data stored in ACNUC8465 zone)

EMBL: CU928166.PE193

CU928166.PE193       Location/Qualifiers
FT   CDS             394777..395400
FT                   /locus_tag="KLTH0B04796g"
FT                   /old_locus_tag="KLTH-ORF15313"
FT                   /product="KLTH0B04796p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04796g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21558"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP7"
FT                   /protein_id="CAR21558.1"
FT                   /translation="MLRSTASHALRIPSRLVATPAVYSSASRVCALHSSARVPKSLGEK
FT                   VRSTLSDLNKKVGEAAASGIDKAQEASHTVEEKSHTAAEATKHGLEQLNKKTGQAAASG
FT                   IDKAQNMAQEAGEKAQELKKRDLTQEAKGKAQELKDSDLAQEAKDKAQDLKEGAQEKAG
FT                   EAKGKAQELKHEGKGKAQELKHEAKGKAHEGAAKAKETAREYKD"
     MLRSTASHAL RIPSRLVATP AVYSSASRVC ALHSSARVPK SLGEKVRSTL SDLNKKVGEA        60
     AASGIDKAQE ASHTVEEKSH TAAEATKHGL EQLNKKTGQA AASGIDKAQN MAQEAGEKAQ       120
     ELKKRDLTQE AKGKAQELKD SDLAQEAKDK AQDLKEGAQE KAGEAKGKAQ ELKHEGKGKA       180
     QELKHEAKGK AHEGAAKAKE TAREYKD                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page