(data stored in SCRATCH zone)

EMBL: CU928166.PE194

CU928166.PE194       Location/Qualifiers
FT   CDS             complement(395490..396632)
FT                   /locus_tag="KLTH0B04818g"
FT                   /old_locus_tag="KLTH-ORF15307"
FT                   /product="KLTH0B04818p"
FT                   /note="weakly similar to uniprot|P80667 Saccharomyces
FT                   cerevisiae YLR191W PEX13 Integral peroxisomal membrane
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04818g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21559"
FT                   /db_xref="GOA:C5DCP8"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007223"
FT                   /db_xref="InterPro:IPR035463"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP8"
FT                   /protein_id="CAR21559.1"
FT                   /translation="MSTSVKQPRPKPWEAQGGQNTPMDDGAMITAGEAQGTRGEGAKAD
FT                   GNAAPEPPQKPAALGPENGVGARSGLGNAGTFLGSGGPYSSGYGGSLYGGGMGSMYSGG
FT                   YNSMYGGGYGSMYGGGYGSMMGGGYGAGGMYGMNNNGAQTLAESTQATFQLIEGLIGAV
FT                   AGFAQMLEATYMATHNSFFTMVSMAEQISSLKEMVGSFFGIFAAMKMLKRLLYKVTNGR
FT                   AGLAPARAAAGSKSPLVQEFAKFGDASAQAKRRRRMSWKPLLVFVAAVVGFPLLLRKFI
FT                   AKLSEIQQRRLGAGAVGAGAGGTLDPRNLEFARAVYDFTPENPQVEAALRKGDLMAVIS
FT                   KQDPLGNASEWWQVRTKKGDVGYVPSNYVELIRRTRSESS"
     MSTSVKQPRP KPWEAQGGQN TPMDDGAMIT AGEAQGTRGE GAKADGNAAP EPPQKPAALG        60
     PENGVGARSG LGNAGTFLGS GGPYSSGYGG SLYGGGMGSM YSGGYNSMYG GGYGSMYGGG       120
     YGSMMGGGYG AGGMYGMNNN GAQTLAESTQ ATFQLIEGLI GAVAGFAQML EATYMATHNS       180
     FFTMVSMAEQ ISSLKEMVGS FFGIFAAMKM LKRLLYKVTN GRAGLAPARA AAGSKSPLVQ       240
     EFAKFGDASA QAKRRRRMSW KPLLVFVAAV VGFPLLLRKF IAKLSEIQQR RLGAGAVGAG       300
     AGGTLDPRNL EFARAVYDFT PENPQVEAAL RKGDLMAVIS KQDPLGNASE WWQVRTKKGD       360
     VGYVPSNYVE LIRRTRSESS                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page