(data stored in SCRATCH zone)

EMBL: CU928166.PE195

CU928166.PE195       Location/Qualifiers
FT   CDS             complement(397225..398769)
FT                   /locus_tag="KLTH0B04862g"
FT                   /old_locus_tag="KLTH-ORF15300"
FT                   /product="KLTH0B04862p"
FT                   /note="some similarities with uniprot|Q06324 Saccharomyces
FT                   cerevisiae YLR190W MMR1 Phosphorylated protein of the
FT                   mitochondrial outer membrane localizes only to mitochondria
FT                   of the bud interacts with Myo2p to mediate mitochondrial
FT                   distribution to buds mRNA is targeted to the bud via the
FT                   transport system involving She2p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04862g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21560"
FT                   /db_xref="InterPro:IPR013712"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCP9"
FT                   /protein_id="CAR21560.1"
FT                   /translation="MNTPPMGAEKLTPKMSPTMLHLDDSLAPLANPSFMYLDESKSNYP
FT                   AMYRTSLSKLTERGRSGRGRTVEAKTPTKLLRSNSPIRAMLNNPPKMLKPEYIGISKLL
FT                   NNNNSSRVGSAVTPSMILTSSKLNFGNTKKASSEEVRQPTQTQEAKKQVVAPPPTPTPV
FT                   PQTEEPALPQATTASQQMPPPSAQPRTQKHPEPAVHSHHGEKVPQPKQRHHSQMLSHKD
FT                   SRGSKHARGLSSTSTAISGSTACELRTEHAAALPTPGSVEEIATKTPGYRFPSTTSTAS
FT                   SSSTFDLKEFPEALNLNFEVPNDKEEFVLATQSKRSSYISSIGSANEDDLNGWFAQYAE
FT                   DRQVSTLSMGDAQKEKALQTEHFSLRVKQLELQIAELRLQNEEMRHNITAHRTIQDRCM
FT                   FEALHDVQREKENTYKEMDRKMKQLEKQINNYRKVIQKLTNSTKTAPVSKPRIPMLDAL
FT                   ALDEISETRSSDGEEDEHVDDATIISELNPDERSASASQSPRKRPAGFNLSLTFEK"
     MNTPPMGAEK LTPKMSPTML HLDDSLAPLA NPSFMYLDES KSNYPAMYRT SLSKLTERGR        60
     SGRGRTVEAK TPTKLLRSNS PIRAMLNNPP KMLKPEYIGI SKLLNNNNSS RVGSAVTPSM       120
     ILTSSKLNFG NTKKASSEEV RQPTQTQEAK KQVVAPPPTP TPVPQTEEPA LPQATTASQQ       180
     MPPPSAQPRT QKHPEPAVHS HHGEKVPQPK QRHHSQMLSH KDSRGSKHAR GLSSTSTAIS       240
     GSTACELRTE HAAALPTPGS VEEIATKTPG YRFPSTTSTA SSSSTFDLKE FPEALNLNFE       300
     VPNDKEEFVL ATQSKRSSYI SSIGSANEDD LNGWFAQYAE DRQVSTLSMG DAQKEKALQT       360
     EHFSLRVKQL ELQIAELRLQ NEEMRHNITA HRTIQDRCMF EALHDVQREK ENTYKEMDRK       420
     MKQLEKQINN YRKVIQKLTN STKTAPVSKP RIPMLDALAL DEISETRSSD GEEDEHVDDA       480
     TIISELNPDE RSASASQSPR KRPAGFNLSL TFEK                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page