(data stored in ACNUC8465 zone)

EMBL: CU928166.PE196

CU928166.PE196       Location/Qualifiers
FT   CDS             400193..401914
FT                   /locus_tag="KLTH0B04884g"
FT                   /old_locus_tag="KLTH-ORF15294"
FT                   /product="KLTH0B04884p"
FT                   /note="highly similar to uniprot|P00927 Saccharomyces
FT                   cerevisiae YER086W ILV1 Threonine deaminase catalyzes the
FT                   first step in isoleucine biosynthesis expression is under
FT                   general amino acid control ILV1 locus exhibits highly
FT                   positioned nucleosomes whose organization is independent of
FT                   known ILV1 regulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04884g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21561"
FT                   /db_xref="GOA:C5DCQ0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ0"
FT                   /protein_id="CAR21561.1"
FT                   /translation="MASKISSQELKMSSTLLTRTRPALVSRFLLRYQSSAVANLQKLHA
FT                   KLNPDELLPDSTPDYVRLILRSSVYDVIEESPITRGVGLSSRLNTNVQLKREDLLPVFS
FT                   FKLRGAYNMMAKLSEAQKNQGVIACSAGNHAQGVAFASRHLNIPAIIVMPVNTPSIKYQ
FT                   NVSRLGGQVVLYGNDFDEAKTECTRISEERGLTNIPPFDHPYVIAGQGTVAMEILRQVH
FT                   NAAKIGAVFVPVGGGGLVAGVAAYLKRIAPHIKIIGVETYDSATLKTSLEAGTRTPLST
FT                   VGTFADGTSVRMIGEETFRICQDLVDDVILVNTDEICAAVKDIFEDTRSIVEPSGALAV
FT                   AGLKKYVTQVHPDVDHSKKTYVPILSGANMNFDRLRFVSERAVLGEGKEVFMLVTIPDV
FT                   PGSFKQLQRVIHPRAVTEFSYRYNEHRHSSASDVPKAYIYTSFSVVDREKEIKQVLQQL
FT                   HGLGFDAVDISDNEMAKSHGRYLVGGASKVPNEKIVSFEFPERPGALTKFLDGMSDSWN
FT                   LTLFHYRNHGSDVGKVLAGVSVSAEDNEGFQKFLDDLGYKYQDETNNMVYQKFLKF"
     MASKISSQEL KMSSTLLTRT RPALVSRFLL RYQSSAVANL QKLHAKLNPD ELLPDSTPDY        60
     VRLILRSSVY DVIEESPITR GVGLSSRLNT NVQLKREDLL PVFSFKLRGA YNMMAKLSEA       120
     QKNQGVIACS AGNHAQGVAF ASRHLNIPAI IVMPVNTPSI KYQNVSRLGG QVVLYGNDFD       180
     EAKTECTRIS EERGLTNIPP FDHPYVIAGQ GTVAMEILRQ VHNAAKIGAV FVPVGGGGLV       240
     AGVAAYLKRI APHIKIIGVE TYDSATLKTS LEAGTRTPLS TVGTFADGTS VRMIGEETFR       300
     ICQDLVDDVI LVNTDEICAA VKDIFEDTRS IVEPSGALAV AGLKKYVTQV HPDVDHSKKT       360
     YVPILSGANM NFDRLRFVSE RAVLGEGKEV FMLVTIPDVP GSFKQLQRVI HPRAVTEFSY       420
     RYNEHRHSSA SDVPKAYIYT SFSVVDREKE IKQVLQQLHG LGFDAVDISD NEMAKSHGRY       480
     LVGGASKVPN EKIVSFEFPE RPGALTKFLD GMSDSWNLTL FHYRNHGSDV GKVLAGVSVS       540
     AEDNEGFQKF LDDLGYKYQD ETNNMVYQKF LKF                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page