(data stored in ACNUC8465 zone)

EMBL: CU928166.PE198

CU928166.PE198       Location/Qualifiers
FT   CDS             complement(403949..404218)
FT                   /locus_tag="KLTH0B04928g"
FT                   /old_locus_tag="Klth0B.mRNA.pd.5.m"
FT                   /product="KLTH0B04928p"
FT                   /note="highly similar to uniprot|P52871 Saccharomyces
FT                   cerevisiae YER019C-A SBH2 Ssh1p-Sss1p-Sbh2p complex
FT                   component involved in protein translocation into the
FT                   endoplasmic reticulum homologous to Sbh1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04928g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21563"
FT                   /db_xref="GOA:C5DCQ2"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR030671"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ2"
FT                   /protein_id="CAR21563.1"
FT                   /translation="MSTPTPPGGQRTLQKRRQAQSVKEKQQKQTPASTRQAGFGGSSNS
FT                   VLKLYTDEANGLRVDPLVVLFLAVGFIFSVVALHVVAKVTGKLF"
     MSTPTPPGGQ RTLQKRRQAQ SVKEKQQKQT PASTRQAGFG GSSNSVLKLY TDEANGLRVD        60
     PLVVLFLAVG FIFSVVALHV VAKVTGKLF                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page