(data stored in SCRATCH zone)

EMBL: CU928166.PE199

CU928166.PE199       Location/Qualifiers
FT   CDS             405537..407279
FT                   /locus_tag="KLTH0B04950g"
FT                   /old_locus_tag="KLTH-ORF15281"
FT                   /product="KLTH0B04950p"
FT                   /note="some similarities with uniprot|P34217 Saccharomyces
FT                   cerevisiae YBL051C PIN4 Protein involved in G2/M phase
FT                   progression and response to DNA damage interacts with
FT                   Rad53p contains an RNA recognition motif a nuclear
FT                   localization signal and several SQ/TQ cluster domains
FT                   hyperphosphorylated in response to DNA damage"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04950g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21564"
FT                   /db_xref="GOA:C5DCQ3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034069"
FT                   /db_xref="InterPro:IPR034186"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ3"
FT                   /protein_id="CAR21564.1"
FT                   /translation="MSDMPAATLQEPLMGNSAAMGGSVFAPRSPEDDVIPTAIVIKNIP
FT                   FAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFATTDETTQVVHSLNGKEIG
FT                   GRKLRVEYKKMLPQAERERIEREKREKRGQLEEQHRATSALSLHSLNKSPNVASGPAAA
FT                   AGSNANTNETAGGAAAGSAAASTSGPTQSASQALSNPASSQMFNDFGSSGGANATGGPI
FT                   NSVLSSQPAMSSQPLLSAQNTATSMVLPPALPVGSSERYYAPLPASNNLPLPPQQLDFN
FT                   DPDTLELYSQLLLFKDREKAYHELAYPVGLSASHKRVINVLCSFLGLVEVYDPSFIIIR
FT                   RKVLDHAALQSHLQQEGQLSLMQPLQPSSTGGSGMSRSHSYTSLLQAHATAAAAAVNSV
FT                   GGQSQHIPPPSQSPLLQPTAIHQMESQHQQQQSLLRQQATQTPSSSILQNRIPTGYATK
FT                   HTTPSGMNNPLLRNAGVSPTTGQVQPNTVQRMPSFYSQAPSTPNLSDNRYGSTQNLVPQ
FT                   HTNGSVHSNYSVHSFHDPSAADPQNHAMMYSSVSQLGIGPELEGDLSRSLSGLDLQGKK
FT                   NLWG"
     MSDMPAATLQ EPLMGNSAAM GGSVFAPRSP EDDVIPTAIV IKNIPFAIKK EQLLEVIAKM        60
     DLPLPYAFNY HFDNGVFRGL AFANFATTDE TTQVVHSLNG KEIGGRKLRV EYKKMLPQAE       120
     RERIEREKRE KRGQLEEQHR ATSALSLHSL NKSPNVASGP AAAAGSNANT NETAGGAAAG       180
     SAAASTSGPT QSASQALSNP ASSQMFNDFG SSGGANATGG PINSVLSSQP AMSSQPLLSA       240
     QNTATSMVLP PALPVGSSER YYAPLPASNN LPLPPQQLDF NDPDTLELYS QLLLFKDREK       300
     AYHELAYPVG LSASHKRVIN VLCSFLGLVE VYDPSFIIIR RKVLDHAALQ SHLQQEGQLS       360
     LMQPLQPSST GGSGMSRSHS YTSLLQAHAT AAAAAVNSVG GQSQHIPPPS QSPLLQPTAI       420
     HQMESQHQQQ QSLLRQQATQ TPSSSILQNR IPTGYATKHT TPSGMNNPLL RNAGVSPTTG       480
     QVQPNTVQRM PSFYSQAPST PNLSDNRYGS TQNLVPQHTN GSVHSNYSVH SFHDPSAADP       540
     QNHAMMYSSV SQLGIGPELE GDLSRSLSGL DLQGKKNLWG                             580
//

If you have problems or comments...

PBIL Back to PBIL home page