(data stored in SCRATCH zone)

EMBL: CU928166.PE200

CU928166.PE200       Location/Qualifiers
FT   CDS             408153..409235
FT                   /locus_tag="KLTH0B04972g"
FT                   /old_locus_tag="KLTH-ORF15272"
FT                   /product="KLTH0B04972p"
FT                   /note="highly similar to uniprot|Q04894 Saccharomyces
FT                   cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
FT                   dehydrogenase family member with broad substrate
FT                   specificity may be involved in fusel alcohol synthesis or
FT                   in aldehyde tolerance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04972g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21565"
FT                   /db_xref="GOA:C5DCQ4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ4"
FT                   /protein_id="CAR21565.1"
FT                   /translation="MSYPEKFQGIAVQDHNDWTHPKKISYEPKKFDDYDVDVEIEACGI
FT                   CGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKCHTGVKVGDRVGVGAQVSSCLDCD
FT                   RCNSDFEPYCAEFITTYSQPYPDGYVSQGGYASHIRAHEHFVIPIPEKIPTHLAAPLLC
FT                   GGITVFSPLINNDCGPNKKVGIVGIGGIGHMGLIFAKALGAEVYAISRSSAKKEDAMKL
FT                   GADHFIATKEEPDWEKKYASTLDLVIVCASSLTEINLEQLIKTMRIKGRIISICVPKET
FT                   EELNLKPFQLSGITIGNSQLGSRKELIQLLQLVADKDLKIWVETLPISEESVHDAFVRM
FT                   EKGDVRYRFTLTDFDKEFRN"
     MSYPEKFQGI AVQDHNDWTH PKKISYEPKK FDDYDVDVEI EACGICGSDT HCASGNWGPK        60
     SLPLVVGHEV IGRVVRVGPK CHTGVKVGDR VGVGAQVSSC LDCDRCNSDF EPYCAEFITT       120
     YSQPYPDGYV SQGGYASHIR AHEHFVIPIP EKIPTHLAAP LLCGGITVFS PLINNDCGPN       180
     KKVGIVGIGG IGHMGLIFAK ALGAEVYAIS RSSAKKEDAM KLGADHFIAT KEEPDWEKKY       240
     ASTLDLVIVC ASSLTEINLE QLIKTMRIKG RIISICVPKE TEELNLKPFQ LSGITIGNSQ       300
     LGSRKELIQL LQLVADKDLK IWVETLPISE ESVHDAFVRM EKGDVRYRFT LTDFDKEFRN       360
//

If you have problems or comments...

PBIL Back to PBIL home page