(data stored in ACNUC8465 zone)

EMBL: CU928166.PE201

CU928166.PE201       Location/Qualifiers
FT   CDS             409558..411780
FT                   /locus_tag="KLTH0B04994g"
FT                   /old_locus_tag="KLTH-ORF15270"
FT                   /product="KLTH0B04994p"
FT                   /note="some similarities with uniprot|P34218 Saccharomyces
FT                   cerevisiae YBL052C SAS3 Histone acetyltransferase catalytic
FT                   subunit of NuA3 complex that acetylates histone H3 involved
FT                   in transcriptional silencing homolog of the mammalian MOZ
FT                   proto-oncogene sas3 gcn5 double mutation confers lethality"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B04994g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21566"
FT                   /db_xref="GOA:C5DCQ5"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037995"
FT                   /db_xref="InterPro:IPR040706"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ5"
FT                   /protein_id="CAR21566.1"
FT                   /translation="MGSKDVNSQRHQRLLRNIEITDNVHAVTANEIARNPDGYARQTRA
FT                   KLAYHPRDEKTELQVKPNLQWSLPDDAKEANALSSHVEFIKVDPVRGTFNKHIVKLRYD
FT                   PRKLLSFDNLINNAAPDPQKYHVDFEIREPETLFNRIDNECSKPYRCAIGDRRDYSTQR
FT                   TTPSLKDREFFQSLLHKAAPASYYNGNLLLAFNEAEEREITNPKKNKSRKAPSKIEYIY
FT                   FRDHEIKTWYTAPYPEEFNKNKILYICEYCLKYMNSRYVIHRHQLKCSLRHPPGNEIYR
FT                   EGNISIWEVDGRENVIYCQNLCLLAKLFLNSKTLYYDVEPFIFYVLTEREDTGEESQFH
FT                   FVGYFSKEKLTSTDYNLSCILTLPIYQRKGYGHFLVDFSYLLTRREYKWGTPEKPLSDL
FT                   GLLSYRNFWKTKICEVLGELKEEINHAEKKGEILHCSIEDLSNLTGMIPTDVVFGLEQI
FT                   GALHYYKGESKLQFAIKIDNWSLIDEVNNARKSKGYRALVPEKLVWKPMIFGPSCGINA
FT                   MGTMIETTTGAARSTATGQQNGIDTFKNSVSVLVNFLRDDIEDPRSMEAICQQKIHDQQ
FT                   GRHFDTSKINLMTLAFNAPVSRRLKNSASSLVSVPNRYDDNETNNNTFSAPNGGADLGI
FT                   VDPELLEETEQIDEEDEDNDLNETLADGDTIGDEEVKFSSTSEDEEEDEDEEIPGRGVS
FT                   SSQGRFSRTRSGRAINSHRVIDSDEHEEEHIATRRLRSMDPLLKNL"
     MGSKDVNSQR HQRLLRNIEI TDNVHAVTAN EIARNPDGYA RQTRAKLAYH PRDEKTELQV        60
     KPNLQWSLPD DAKEANALSS HVEFIKVDPV RGTFNKHIVK LRYDPRKLLS FDNLINNAAP       120
     DPQKYHVDFE IREPETLFNR IDNECSKPYR CAIGDRRDYS TQRTTPSLKD REFFQSLLHK       180
     AAPASYYNGN LLLAFNEAEE REITNPKKNK SRKAPSKIEY IYFRDHEIKT WYTAPYPEEF       240
     NKNKILYICE YCLKYMNSRY VIHRHQLKCS LRHPPGNEIY REGNISIWEV DGRENVIYCQ       300
     NLCLLAKLFL NSKTLYYDVE PFIFYVLTER EDTGEESQFH FVGYFSKEKL TSTDYNLSCI       360
     LTLPIYQRKG YGHFLVDFSY LLTRREYKWG TPEKPLSDLG LLSYRNFWKT KICEVLGELK       420
     EEINHAEKKG EILHCSIEDL SNLTGMIPTD VVFGLEQIGA LHYYKGESKL QFAIKIDNWS       480
     LIDEVNNARK SKGYRALVPE KLVWKPMIFG PSCGINAMGT MIETTTGAAR STATGQQNGI       540
     DTFKNSVSVL VNFLRDDIED PRSMEAICQQ KIHDQQGRHF DTSKINLMTL AFNAPVSRRL       600
     KNSASSLVSV PNRYDDNETN NNTFSAPNGG ADLGIVDPEL LEETEQIDEE DEDNDLNETL       660
     ADGDTIGDEE VKFSSTSEDE EEDEDEEIPG RGVSSSQGRF SRTRSGRAIN SHRVIDSDEH       720
     EEEHIATRRL RSMDPLLKNL                                                   740
//

If you have problems or comments...

PBIL Back to PBIL home page