(data stored in ACNUC8465 zone)

EMBL: CU928166.PE203

CU928166.PE203       Location/Qualifiers
FT   CDS             join(415138..415176,415852..416868)
FT                   /locus_tag="KLTH0B05038g"
FT                   /old_locus_tag="Klth0B.mRNA.296.p"
FT                   /product="KLTH0B05038p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05038g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21568"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ7"
FT                   /protein_id="CAR21568.1"
FT                   /translation="MPLSMIEALSCSALTGFCKSDFDRVVEALKIPSYIGAYSFDAFEC
FT                   FFIFIARLKSGCTYTVLTSLCGREASTISRIITFVTCYLFHIASPCLSVTNASWLADRL
FT                   ANIDQSLLSSSRSISNSRIVGFIDGTHVKIARPHGNARLECVAYSGHKKTHTLKYQAVT
FT                   TPDGICIDLAGPFAGSQHDSFLFTNSGLYRRLKPALKVGGIQYRIFGDPAYRSSDLLTV
FT                   GYKGQNLTNGQKEYNTILSGSRVSIEWFFGEVKNNFQIFNILGRLKVGGVRFCGAYFTI
FT                   AVFLTNLKHCLEGSQGSKYFNISPPRFEEYMNGLKFPQYFDGFLIDVNGTSSFFSKQYE
FT                   HLSFDRLGNIL"
     MPLSMIEALS CSALTGFCKS DFDRVVEALK IPSYIGAYSF DAFECFFIFI ARLKSGCTYT        60
     VLTSLCGREA STISRIITFV TCYLFHIASP CLSVTNASWL ADRLANIDQS LLSSSRSISN       120
     SRIVGFIDGT HVKIARPHGN ARLECVAYSG HKKTHTLKYQ AVTTPDGICI DLAGPFAGSQ       180
     HDSFLFTNSG LYRRLKPALK VGGIQYRIFG DPAYRSSDLL TVGYKGQNLT NGQKEYNTIL       240
     SGSRVSIEWF FGEVKNNFQI FNILGRLKVG GVRFCGAYFT IAVFLTNLKH CLEGSQGSKY       300
     FNISPPRFEE YMNGLKFPQY FDGFLIDVNG TSSFFSKQYE HLSFDRLGNI L                351
//

If you have problems or comments...

PBIL Back to PBIL home page