(data stored in SCRATCH zone)

EMBL: CU928166.PE204

CU928166.PE204       Location/Qualifiers
FT   CDS             complement(416976..418274)
FT                   /locus_tag="KLTH0B05060g"
FT                   /old_locus_tag="KLTH-ORF15253"
FT                   /product="KLTH0B05060p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05060g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ8"
FT                   /protein_id="CAR21569.1"
FT                   /translation="MESGKRQSINSPARPAPREISCSETLLNDGDDDAQANSTEIDNHD
FT                   METGRDVSPSPRNLVGTTSHDEMQQEQLYLEYFHSAIITEELGLIKHLKRAHGKMIKAI
FT                   QELIRVKGYRSADSGKEYRFKWTDNATYYLLKYCLEIGPFYGFEHLKRPSLTKLEQSSL
FT                   ISLKWSCVWYDLLMTLEFENSIIPTESQIKSKCRYLLDNAHPKLFAVTTGDERNPFSFT
FT                   GVDKVDNNLEMLTRLKNDAEQRKVEIQKLETDRQNNKRTLGQMLCSNSIPSVTEGLSNS
FT                   DSEEPSSIDDINQPNSITMRRNKRMGRLLDFKEIAQYSLSNSALVGDLQETLKELIEAA
FT                   AVEERKYKDKEQQRKDQELALKQKKLEISLQHNQRMLELELERQKREQFDHDAKKIDTL
FT                   VKMMDRAKSLEGDKSPSSEALQKLLHNFVSRYT"
     MESGKRQSIN SPARPAPREI SCSETLLNDG DDDAQANSTE IDNHDMETGR DVSPSPRNLV        60
     GTTSHDEMQQ EQLYLEYFHS AIITEELGLI KHLKRAHGKM IKAIQELIRV KGYRSADSGK       120
     EYRFKWTDNA TYYLLKYCLE IGPFYGFEHL KRPSLTKLEQ SSLISLKWSC VWYDLLMTLE       180
     FENSIIPTES QIKSKCRYLL DNAHPKLFAV TTGDERNPFS FTGVDKVDNN LEMLTRLKND       240
     AEQRKVEIQK LETDRQNNKR TLGQMLCSNS IPSVTEGLSN SDSEEPSSID DINQPNSITM       300
     RRNKRMGRLL DFKEIAQYSL SNSALVGDLQ ETLKELIEAA AVEERKYKDK EQQRKDQELA       360
     LKQKKLEISL QHNQRMLELE LERQKREQFD HDAKKIDTLV KMMDRAKSLE GDKSPSSEAL       420
     QKLLHNFVSR YT                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page