(data stored in SCRATCH zone)

EMBL: CU928166.PE205

CU928166.PE205       Location/Qualifiers
FT   CDS             complement(419442..420332)
FT                   /locus_tag="KLTH0B05082g"
FT                   /old_locus_tag="KLTH-ORF15246"
FT                   /product="KLTH0B05082p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05082g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21570"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCQ9"
FT                   /protein_id="CAR21570.1"
FT                   /translation="MALKVGFIPEHFATPLCFAKTVGFFEDQGVEAELIPYPSGSGHLI
FT                   QSLNAGELDIAIGLTEAFVRGIADTEPGQKPQYQIAGTYVKSPLEWCVSTGANRDDLQD
FT                   LKALDGRRIGVSRIGSGSHVMSYVMALQLDFTKPFADFPVLDNFDNLRAAVNSGDADAF
FT                   MWEYYTSKKYLDSGEIKMLGHVESPWPSWVVVKRVDLDLGVFGRFVFAINSGIDYFNKN
FT                   PDEAVRFITENFGYSEEDAASWFKTVKFHDNCGDINDLHGVVTGTLHILGTAGVLQNKD
FT                   EVVIEENLRVGTLTG"
     MALKVGFIPE HFATPLCFAK TVGFFEDQGV EAELIPYPSG SGHLIQSLNA GELDIAIGLT        60
     EAFVRGIADT EPGQKPQYQI AGTYVKSPLE WCVSTGANRD DLQDLKALDG RRIGVSRIGS       120
     GSHVMSYVMA LQLDFTKPFA DFPVLDNFDN LRAAVNSGDA DAFMWEYYTS KKYLDSGEIK       180
     MLGHVESPWP SWVVVKRVDL DLGVFGRFVF AINSGIDYFN KNPDEAVRFI TENFGYSEED       240
     AASWFKTVKF HDNCGDINDL HGVVTGTLHI LGTAGVLQNK DEVVIEENLR VGTLTG           296
//

If you have problems or comments...

PBIL Back to PBIL home page