(data stored in ACNUC8465 zone)

EMBL: CU928166.PE206

CU928166.PE206       Location/Qualifiers
FT   CDS             420999..423680
FT                   /locus_tag="KLTH0B05104g"
FT                   /old_locus_tag="KLTH-ORF15241"
FT                   /product="KLTH0B05104p"
FT                   /note="similar to uniprot|P53550 Saccharomyces cerevisiae
FT                   YNL118C DCP2 Protein required for the decapping of mRNAs
FT                   functions to allow the production of active Dcp1p contains
FT                   a pyrophosphatase MutT motif and several alpha- helical
FT                   leucine-rich motifs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05104g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21571"
FT                   /db_xref="GOA:C5DCR0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR007722"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR036189"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR0"
FT                   /protein_id="CAR21571.1"
FT                   /translation="MSLPLRRPLESVTSLDRVLEDLIVRFIINCPPEDFSSVERELFHV
FT                   EEATWFYTDFVKLMNPKMPNMKIKSFAQHVIKLCPMVWKWDVRAEQALQKFSQYKRSIP
FT                   VRGAAIFNRSLTKLLLVKGIESESWSFPRGKISKDEGDVDCCIREVLEEIGFDISDYID
FT                   EDQFIERTIAGKNYKIFLVSGVPEDFDFQPQVRNEIEKIQWHDFKKLSRNNGNKQHVKI
FT                   YLVNTLMRPLAMWVKSHRQIDNDDKLKAHVETQLKLLLGIKKEETPDPGRELLNMLQSS
FT                   VAAPQEALAAAPQSPSELPPSSKSSQDSTPATNAAPPMKSPPPQLHHNFPFMLFQPFAP
FT                   FPFMAGAGMQTGGPVPGLDTSSSNSVQTQPPPTPSMNTLAKPTVAEEEEEEEEQQQQQR
FT                   DSQQFQLLEPPRPQSTTSKQLLDLLNRKSSEKAEPTEQQTTKPKFKILKRGESLTPTPS
FT                   APQNDNEADSKALLNLLKKPQEPSITRETEDAQPTTMIEKPIATPLEDLPHEEEASLHF
FT                   ANTHSAAAASESEYEDFESSSEEEDIGNDEEEAKASSLKGEGNFGQKFEHTSTNPNVGY
FT                   GHDQTRISGPMQGLKEQSSGAADVPHKDSSNLSEQSTGGTFITQSSKSQTKPKIKLLKR
FT                   GESLKDMIFTNGNKTLETSEASHVVKTTSHEGESNELLKLLKKDAISSTADFTNAEAAI
FT                   HRDSTSARRGTEGSSPLSTTVNQHVTPGQQPISSALTGSDDAKDLLNILHRKNQASQSY
FT                   QLQSTPEIQQALCTVDTSRGNSSMAAGDFLNMLPNGSSVSSPTAAGNFLPGMEAQFRNP
FT                   YYNQYPTSSGVPIPPQFPVQPPYAQSPPQNQNSSQQLLGMLKNPHAGIAASPAVNSAST
FT                   SDTPFVSEKGASHELLSLLQRR"
     MSLPLRRPLE SVTSLDRVLE DLIVRFIINC PPEDFSSVER ELFHVEEATW FYTDFVKLMN        60
     PKMPNMKIKS FAQHVIKLCP MVWKWDVRAE QALQKFSQYK RSIPVRGAAI FNRSLTKLLL       120
     VKGIESESWS FPRGKISKDE GDVDCCIREV LEEIGFDISD YIDEDQFIER TIAGKNYKIF       180
     LVSGVPEDFD FQPQVRNEIE KIQWHDFKKL SRNNGNKQHV KIYLVNTLMR PLAMWVKSHR       240
     QIDNDDKLKA HVETQLKLLL GIKKEETPDP GRELLNMLQS SVAAPQEALA AAPQSPSELP       300
     PSSKSSQDST PATNAAPPMK SPPPQLHHNF PFMLFQPFAP FPFMAGAGMQ TGGPVPGLDT       360
     SSSNSVQTQP PPTPSMNTLA KPTVAEEEEE EEEQQQQQRD SQQFQLLEPP RPQSTTSKQL       420
     LDLLNRKSSE KAEPTEQQTT KPKFKILKRG ESLTPTPSAP QNDNEADSKA LLNLLKKPQE       480
     PSITRETEDA QPTTMIEKPI ATPLEDLPHE EEASLHFANT HSAAAASESE YEDFESSSEE       540
     EDIGNDEEEA KASSLKGEGN FGQKFEHTST NPNVGYGHDQ TRISGPMQGL KEQSSGAADV       600
     PHKDSSNLSE QSTGGTFITQ SSKSQTKPKI KLLKRGESLK DMIFTNGNKT LETSEASHVV       660
     KTTSHEGESN ELLKLLKKDA ISSTADFTNA EAAIHRDSTS ARRGTEGSSP LSTTVNQHVT       720
     PGQQPISSAL TGSDDAKDLL NILHRKNQAS QSYQLQSTPE IQQALCTVDT SRGNSSMAAG       780
     DFLNMLPNGS SVSSPTAAGN FLPGMEAQFR NPYYNQYPTS SGVPIPPQFP VQPPYAQSPP       840
     QNQNSSQQLL GMLKNPHAGI AASPAVNSAS TSDTPFVSEK GASHELLSLL QRR              893
//

If you have problems or comments...

PBIL Back to PBIL home page