(data stored in ACNUC8465 zone)

EMBL: CU928166.PE207

CU928166.PE207       Location/Qualifiers
FT   CDS             complement(423735..425168)
FT                   /locus_tag="KLTH0B05126g"
FT                   /old_locus_tag="KLTH-ORF15236"
FT                   /product="KLTH0B05126p"
FT                   /note="similar to uniprot|P53923 Saccharomyces cerevisiae
FT                   YNL119W NCS2 Protein with a role in urmylation and in
FT                   invasive and pseudohyphal growth inhibits replication of
FT                   Brome mosaic virus in S. cerevisiae which is a model system
FT                   for studying replication of positive- strand RNA viruses in
FT                   their natural hosts"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05126g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21572"
FT                   /db_xref="GOA:C5DCR1"
FT                   /db_xref="InterPro:IPR019407"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR1"
FT                   /protein_id="CAR21572.1"
FT                   /translation="MGINQLCKRCKTAEAAVVSRKEPFCIACFRKFVSLKQRKQMMSDQ
FT                   YFQDIFKVMYPDKKKTAEEAERLNQGSRILVPLSFGSSSIVMLDVLNDTLTEQREMHRG
FT                   KTGFRIDVLVCYLKDDLEELKRKAEALMTVKLRDNKNSVKVHLVDIESSMNSPDFTRIH
FT                   LQDSTYMVRNASVSANEAQSVKELLSSCSNRSAREDLLNIIKTAIIKRFGVQGGYKAIL
FT                   WGHSTTRLADEIMSLVVKGRASQIANALNDSEEDFEYGEPLRNLHPMRDILLSEIDAYC
FT                   FVSDLTQYLHKYKPQDTLLVNKIPVAPDAQPPRAKLTKNMTINELARQYFDGIEGSYSN
FT                   VISTVVRTGAKLDDPENSLKSKVRCGICNNTVFCDGSHWLRNITVTSSHPIEDAEEEAM
FT                   FRAWSASEQGKVRGEYLKLTSEMEISGHEFPVCYGCILTLGEVKHKSLIWPSSQSNSVE
FT                   SVIEDFIISDESDSEHEGH"
     MGINQLCKRC KTAEAAVVSR KEPFCIACFR KFVSLKQRKQ MMSDQYFQDI FKVMYPDKKK        60
     TAEEAERLNQ GSRILVPLSF GSSSIVMLDV LNDTLTEQRE MHRGKTGFRI DVLVCYLKDD       120
     LEELKRKAEA LMTVKLRDNK NSVKVHLVDI ESSMNSPDFT RIHLQDSTYM VRNASVSANE       180
     AQSVKELLSS CSNRSAREDL LNIIKTAIIK RFGVQGGYKA ILWGHSTTRL ADEIMSLVVK       240
     GRASQIANAL NDSEEDFEYG EPLRNLHPMR DILLSEIDAY CFVSDLTQYL HKYKPQDTLL       300
     VNKIPVAPDA QPPRAKLTKN MTINELARQY FDGIEGSYSN VISTVVRTGA KLDDPENSLK       360
     SKVRCGICNN TVFCDGSHWL RNITVTSSHP IEDAEEEAMF RAWSASEQGK VRGEYLKLTS       420
     EMEISGHEFP VCYGCILTLG EVKHKSLIWP SSQSNSVESV IEDFIISDES DSEHEGH          477
//

If you have problems or comments...

PBIL Back to PBIL home page