(data stored in SCRATCH zone)

EMBL: CU928166.PE209

CU928166.PE209       Location/Qualifiers
FT   CDS             427608..429389
FT                   /locus_tag="KLTH0B05170g"
FT                   /old_locus_tag="KLTH-ORF15233"
FT                   /product="KLTH0B05170p"
FT                   /note="similar to uniprot|P07213 Saccharomyces cerevisiae
FT                   YNL121C TOM70 Translocase of Outer Mitochondrial membrane
FT                   70 kDa mitochondrial specialized import receptor of the
FT                   outer membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05170g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21574"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR3"
FT                   /protein_id="CAR21574.1"
FT                   /translation="MSSDNSFGQFVARNKTAIVASVAAGATAVGAYYYYQQLQRQPANK
FT                   KEPESESKSSKKKKKTKKKAPGPSYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNE
FT                   FFKNKKYDEAIQYYSWAIEVKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSK
FT                   CLLRRASANESLGNFADAMFDLSAVSLYGDFSGASIEPLLERNMNKQSMLVLKEKLEKQ
FT                   QEYKLPSNTSLASFFGIFQPETTFENYDDNSEADKYLLEGLTNLYKRTADGYETADLSF
FT                   AKARDAFKVLLEQNPEDADLKRKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPN
FT                   TYIYMALIMADKGQATEYFDNFEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKA
FT                   KELSESNIFPYIQLACLTYREGKFDDSETLFSEARRKFPTAPEVPNFYAETLSDKGDLA
FT                   GARKQYDIAAKLEDALDGIHVGVSPLIGKATLLSREPSVENFVEATQLFEKACQNDPRS
FT                   EQAKIGLAQLKLQQEDIDEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPVV
FT                   SAKIEETLAAYRAQGMI"
     MSSDNSFGQF VARNKTAIVA SVAAGATAVG AYYYYQQLQR QPANKKEPES ESKSSKKKKK        60
     TKKKAPGPSY PVNEKGEPDL SNLAELSDEQ KDKYAMGLKD KGNEFFKNKK YDEAIQYYSW       120
     AIEVKEDPVF YSNRSACYVS LGQQEKVVED TTAALKLKPD YSKCLLRRAS ANESLGNFAD       180
     AMFDLSAVSL YGDFSGASIE PLLERNMNKQ SMLVLKEKLE KQQEYKLPSN TSLASFFGIF       240
     QPETTFENYD DNSEADKYLL EGLTNLYKRT ADGYETADLS FAKARDAFKV LLEQNPEDAD       300
     LKRKAAIALE HVGIFKFLKN DPISAHEDLK KAVEYFPRPN TYIYMALIMA DKGQATEYFD       360
     NFEKALKLDP SCAAVYYHRG QMYFITQQFE QAGKDFEKAK ELSESNIFPY IQLACLTYRE       420
     GKFDDSETLF SEARRKFPTA PEVPNFYAET LSDKGDLAGA RKQYDIAAKL EDALDGIHVG       480
     VSPLIGKATL LSREPSVENF VEATQLFEKA CQNDPRSEQA KIGLAQLKLQ QEDIDEAIAL       540
     FEEAADLARS FDEKLQATTF AEATKIQKKI RADPVVSAKI EETLAAYRAQ GMI              593
//

If you have problems or comments...

PBIL Back to PBIL home page