(data stored in ACNUC8465 zone)

EMBL: CU928166.PE210

CU928166.PE210       Location/Qualifiers
FT   CDS             complement(429511..429930)
FT                   /locus_tag="KLTH0B05192g"
FT                   /old_locus_tag="KLTH-ORF15231"
FT                   /product="KLTH0B05192p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05192g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21575"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR4"
FT                   /protein_id="CAR21575.1"
FT                   /translation="MSFELQILNDVLDWARAPGGPAGDYIHPSHVSLWSYPREKAFQVH
FT                   EGNNNPSSARYGFDSPYGGLVTLESLYKERVDSSGKNYKIESGTSVENFTRKRKFEASA
FT                   EDDFFHLQKDIGVRERSFKKPRGYACKNCCMYSHI"
     MSFELQILND VLDWARAPGG PAGDYIHPSH VSLWSYPREK AFQVHEGNNN PSSARYGFDS        60
     PYGGLVTLES LYKERVDSSG KNYKIESGTS VENFTRKRKF EASAEDDFFH LQKDIGVRER       120
     SFKKPRGYAC KNCCMYSHI                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page