(data stored in ACNUC8465 zone)

EMBL: CU928166.PE212

CU928166.PE212       Location/Qualifiers
FT   CDS             complement(430626..433568)
FT                   /locus_tag="KLTH0B05236g"
FT                   /old_locus_tag="KLTH-ORF15228"
FT                   /product="KLTH0B05236p"
FT                   /note="highly similar to uniprot|P53920 Saccharomyces
FT                   cerevisiae YNL123W shows protein sequence similarity to the
FT                   mammalian Omi/HtrA2 family of serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05236g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21577"
FT                   /db_xref="GOA:C5DCR6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR025926"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR6"
FT                   /protein_id="CAR21577.1"
FT                   /translation="MSLNAKRTHSELSDSECNGRTKLQAANGGHFDSSDEEVSFVEEEI
FT                   VEEPINNAQWQTTISKVVSSVVSIHFSQVAPFDCDSALVSEATGFVVDSELGIILTNRH
FT                   VVGAGPFVGYAVFDNHEECDVIPIYRDPVHDFGFLKFDPKNIKYMQVCALELKPSLAKV
FT                   GSEIRVIGNDAGEKLSILAGFISRIDRNAPDYGELTYNDFNTEYIQAAASASGGSSGSP
FT                   VVNIDGHAVALQAGGSTEASTDFFLPVNRILRALNCIRAKKAVTRGTIQTQWILRPYDE
FT                   CRRLGLTPDREADARKQFPDRIGLLVAETVLREGPGDNKIKEGDTLISINGELIASFIQ
FT                   VDDILDRSVGQTIELLIQRGGKDIKVSCEVGDLHAITPSSYLEVCGATFNELSYQMARF
FT                   YAIPVRGVFLSSASGSFNFDSKEKVGWIVDAIDNQETPTLETFIEVMKKVPDRKRVTVR
FT                   YHHLTDQHSPHVASVYIDRHWCSEFRIYERNDTTGIWDYKNVADPLPPLPEVSHEAKFI
FT                   DLSIDNKQLAKLSRSLVMVSSISPIPLDSLSAEPRKASGLVVDANQGYVVVSRRVIPHD
FT                   CLDVFVTIADSVILPAEVTFLHPTQNYAVVKYDPALVLAPVETPKLSFARMKRGDKAHF
FT                   IGYTHNNRLVSSDTKVTDISSLSVPSNLIPRYRATNLEAIGIDCNVSSRCNSGILADDD
FT                   GTVRALWLSFLGEIQDGKEKVYLMGLDMADLKSVIDLLKEGKKPRINIVDAGFGSISVA
FT                   QARIRGVPEEWISKMEQESENRLQFMNVTRVSFTNEKDKLYPGDVILCVGGKLVKEMRD
FT                   LDGIVTSGEGANEEQVLEFKLVRNGKIVDLSVKTREINETSHFAIFAGCILQAPHHAVL
FT                   QAMMDIPSSVYCTFRGQSSPATQYGIAATNFITHINEIETPDLDTFVKVVKTIPDNTYC
FT                   KIRLVTFDNVPFAISLKTNYHYFPTAELKKDPSSGKWIENELNKTDARSD"
     MSLNAKRTHS ELSDSECNGR TKLQAANGGH FDSSDEEVSF VEEEIVEEPI NNAQWQTTIS        60
     KVVSSVVSIH FSQVAPFDCD SALVSEATGF VVDSELGIIL TNRHVVGAGP FVGYAVFDNH       120
     EECDVIPIYR DPVHDFGFLK FDPKNIKYMQ VCALELKPSL AKVGSEIRVI GNDAGEKLSI       180
     LAGFISRIDR NAPDYGELTY NDFNTEYIQA AASASGGSSG SPVVNIDGHA VALQAGGSTE       240
     ASTDFFLPVN RILRALNCIR AKKAVTRGTI QTQWILRPYD ECRRLGLTPD READARKQFP       300
     DRIGLLVAET VLREGPGDNK IKEGDTLISI NGELIASFIQ VDDILDRSVG QTIELLIQRG       360
     GKDIKVSCEV GDLHAITPSS YLEVCGATFN ELSYQMARFY AIPVRGVFLS SASGSFNFDS       420
     KEKVGWIVDA IDNQETPTLE TFIEVMKKVP DRKRVTVRYH HLTDQHSPHV ASVYIDRHWC       480
     SEFRIYERND TTGIWDYKNV ADPLPPLPEV SHEAKFIDLS IDNKQLAKLS RSLVMVSSIS       540
     PIPLDSLSAE PRKASGLVVD ANQGYVVVSR RVIPHDCLDV FVTIADSVIL PAEVTFLHPT       600
     QNYAVVKYDP ALVLAPVETP KLSFARMKRG DKAHFIGYTH NNRLVSSDTK VTDISSLSVP       660
     SNLIPRYRAT NLEAIGIDCN VSSRCNSGIL ADDDGTVRAL WLSFLGEIQD GKEKVYLMGL       720
     DMADLKSVID LLKEGKKPRI NIVDAGFGSI SVAQARIRGV PEEWISKMEQ ESENRLQFMN       780
     VTRVSFTNEK DKLYPGDVIL CVGGKLVKEM RDLDGIVTSG EGANEEQVLE FKLVRNGKIV       840
     DLSVKTREIN ETSHFAIFAG CILQAPHHAV LQAMMDIPSS VYCTFRGQSS PATQYGIAAT       900
     NFITHINEIE TPDLDTFVKV VKTIPDNTYC KIRLVTFDNV PFAISLKTNY HYFPTAELKK       960
     DPSSGKWIEN ELNKTDARSD                                                   980
//

If you have problems or comments...

PBIL Back to PBIL home page