(data stored in ACNUC8465 zone)

EMBL: CU928166.PE215

CU928166.PE215       Location/Qualifiers
FT   CDS             438719..441667
FT                   /locus_tag="KLTH0B05302g"
FT                   /old_locus_tag="KLTH-ORF15217"
FT                   /product="KLTH0B05302p"
FT                   /note="similar to uniprot|P25846 Saccharomyces cerevisiae
FT                   YHR120W MSH1 DNA-binding protein of the mitochondria
FT                   involved in repair of mitochondrial DNA has ATPase activity
FT                   and binds to DNA mismatches has homology to E. coli MutS
FT                   transcription is induced during meiosis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05302g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21580"
FT                   /db_xref="GOA:C5DCR9"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCR9"
FT                   /protein_id="CAR21580.1"
FT                   /translation="MGRFLSYTKRLSIPNAGILGYCAARPKTGSLLSHLSGNIHQERRC
FT                   FSSVPSTEKLTVPIEHGPGTANADASRLNIELGLPLDNKSIKRSNRGNRTIKNSLPPSL
FT                   QYVRDTMDKYKDFVVLTQMGSFYELYFEHADIYAPKLNLTLTSREYAHGKVSFAGFPVQ
FT                   QVNRHLKVLVKELGYSVAIADQFKRTSAASNESNRFLRRVTRIVTPGTFLDEAFENLQE
FT                   NTYLLSIEFPESCVQKLVDINMKVGLCWCDISTGEIFVQQTLLKDTISAVARIGPREIL
FT                   LDEELFSFKLEEGEWYPEFVELKRFFIKYQKMPSNHRSMNTFRYLFNSGYLEGDFFRLE
FT                   NVLHDFSQKEVAALRNMLLYIEEHLPDTAVNLQEPQRQLTNSLMQIDSRSCSALEITST
FT                   MRANTKKGSLLSAIKRTVTPSGSRLLSQWLSAPSLDTAEIKRRQQLVTLFRNNHELTEL
FT                   LIRTLKQTYDMPRILQKFSFGKGDATELLQLSHSLQKAEFIGKSIKAKCRTKQGVLGNI
FT                   LSSVISPLEYDKQLIGRVLSSLDEDQLMKFTMLQSESESELCEKDQNLEKKDVDAFGES
FT                   SLWVIRPGAGTRISELHGKHQELLKRRRELCNRFESTISDSVQVKGVQLRLRHTGEYGL
FT                   YISATSTNIKLLCSLVKDGMLFRGSPLKILQKSSQSCWLDHRLWTELGQELEYIVMKIK
FT                   REENIVISSFKKEFIKKSFSIRRVSQVLDYLDVLTSFAKLSTEKNLSCPVVDTSSDLDI
FT                   KSGRHIVVEDGLLSKSLQKFTSNDCRLEASNLWVITGPNMGGKSTFLRQIAIIVIMAQI
FT                   GSYVPCESAKIGVVDKIFSRIGSADDLYNQMSTFMVEMTETGYILKGATKRSLAILDEI
FT                   GRGTSGKEGISLAYAALKYLVDRNQCRSLFATHFGQELKTLVDNHCDEAVRKKISYYRS
FT                   GVYDTGGDDFCYDHSLTPGICNNSDAIRVAMRAGFPKEALDNARKALKLSDT"
     MGRFLSYTKR LSIPNAGILG YCAARPKTGS LLSHLSGNIH QERRCFSSVP STEKLTVPIE        60
     HGPGTANADA SRLNIELGLP LDNKSIKRSN RGNRTIKNSL PPSLQYVRDT MDKYKDFVVL       120
     TQMGSFYELY FEHADIYAPK LNLTLTSREY AHGKVSFAGF PVQQVNRHLK VLVKELGYSV       180
     AIADQFKRTS AASNESNRFL RRVTRIVTPG TFLDEAFENL QENTYLLSIE FPESCVQKLV       240
     DINMKVGLCW CDISTGEIFV QQTLLKDTIS AVARIGPREI LLDEELFSFK LEEGEWYPEF       300
     VELKRFFIKY QKMPSNHRSM NTFRYLFNSG YLEGDFFRLE NVLHDFSQKE VAALRNMLLY       360
     IEEHLPDTAV NLQEPQRQLT NSLMQIDSRS CSALEITSTM RANTKKGSLL SAIKRTVTPS       420
     GSRLLSQWLS APSLDTAEIK RRQQLVTLFR NNHELTELLI RTLKQTYDMP RILQKFSFGK       480
     GDATELLQLS HSLQKAEFIG KSIKAKCRTK QGVLGNILSS VISPLEYDKQ LIGRVLSSLD       540
     EDQLMKFTML QSESESELCE KDQNLEKKDV DAFGESSLWV IRPGAGTRIS ELHGKHQELL       600
     KRRRELCNRF ESTISDSVQV KGVQLRLRHT GEYGLYISAT STNIKLLCSL VKDGMLFRGS       660
     PLKILQKSSQ SCWLDHRLWT ELGQELEYIV MKIKREENIV ISSFKKEFIK KSFSIRRVSQ       720
     VLDYLDVLTS FAKLSTEKNL SCPVVDTSSD LDIKSGRHIV VEDGLLSKSL QKFTSNDCRL       780
     EASNLWVITG PNMGGKSTFL RQIAIIVIMA QIGSYVPCES AKIGVVDKIF SRIGSADDLY       840
     NQMSTFMVEM TETGYILKGA TKRSLAILDE IGRGTSGKEG ISLAYAALKY LVDRNQCRSL       900
     FATHFGQELK TLVDNHCDEA VRKKISYYRS GVYDTGGDDF CYDHSLTPGI CNNSDAIRVA       960
     MRAGFPKEAL DNARKALKLS DT                                                982
//

If you have problems or comments...

PBIL Back to PBIL home page