(data stored in SCRATCH zone)

EMBL: CU928166.PE219

CU928166.PE219       Location/Qualifiers
FT   CDS             449461..449811
FT                   /locus_tag="KLTH0B05390g"
FT                   /old_locus_tag="KLTH-ORF15207"
FT                   /product="KLTH0B05390p"
FT                   /note="some similarities with uniprot|P38828 Saccharomyces
FT                   cerevisiae YHR121W LSM12 Protein containing an Lsm domain
FT                   and an AD domain may bind RNA and have a role in RNA
FT                   processing"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05390g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21584"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS3"
FT                   /protein_id="CAR21584.1"
FT                   /translation="MSISLEHILGFKVKVTNVLDVASAGNIYSYNSSNNTITLQLTKSA
FT                   HHAQQFKVIRLSFIKSLEVIGERPTKNSFRKDSMKPIEIRIENVREALQNKVQQAQGAT
FT                   AAIQEHIVTASK"
     MSISLEHILG FKVKVTNVLD VASAGNIYSY NSSNNTITLQ LTKSAHHAQQ FKVIRLSFIK        60
     SLEVIGERPT KNSFRKDSMK PIEIRIENVR EALQNKVQQA QGATAAIQEH IVTASK           116
//

If you have problems or comments...

PBIL Back to PBIL home page