(data stored in SCRATCH zone)

EMBL: CU928166.PE221

CU928166.PE221       Location/Qualifiers
FT   CDS             complement(join(451373..452032,452105..452164))
FT                   /locus_tag="KLTH0B05434g"
FT                   /old_locus_tag="Klth0B.mRNA.vl.393.m"
FT                   /product="KLTH0B05434p"
FT                   /note="similar to uniprot|P53915 Saccharomyces cerevisiae
FT                   YNL129W NRK1 Nicotinamide riboside kinase catalyzes the
FT                   synthesis of nicotinamide nucleotide (NMN) from
FT                   nicotinamide riboside involved in a salvage pathway for NAD
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05434g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21586"
FT                   /db_xref="GOA:C5DCS5"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026681"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS5"
FT                   /protein_id="CAR21586.1"
FT                   /translation="MESPQVLLVGISGCSSSGKTTLAKLSAELLPTAVLIHQDDFFKHD
FT                   EDIPFNDKYQIRDWDSPEALDMNLFGKELDHIKKTGSVSTTLIHNNNHDNSGAAEVRPE
FT                   TQKEVKTKFAKAFEGTNTKVVFVDGFMMFNDQNIKSKFDLKLLVRAPYGTLKKRRAARS
FT                   GYQTLDSFWIDPPYYFDEFVYSSYARSHSQLFEDGNVEGVLKKGSGILDFINDDSTDIN
FT                   DALLWVCNCVVSMAQKK"
     MESPQVLLVG ISGCSSSGKT TLAKLSAELL PTAVLIHQDD FFKHDEDIPF NDKYQIRDWD        60
     SPEALDMNLF GKELDHIKKT GSVSTTLIHN NNHDNSGAAE VRPETQKEVK TKFAKAFEGT       120
     NTKVVFVDGF MMFNDQNIKS KFDLKLLVRA PYGTLKKRRA ARSGYQTLDS FWIDPPYYFD       180
     EFVYSSYARS HSQLFEDGNV EGVLKKGSGI LDFINDDSTD INDALLWVCN CVVSMAQKK        239
//

If you have problems or comments...

PBIL Back to PBIL home page