(data stored in SCRATCH zone)

EMBL: CU928166.PE222

CU928166.PE222       Location/Qualifiers
FT   CDS             454571..455239
FT                   /locus_tag="KLTH0B05456g"
FT                   /old_locus_tag="KLTH-ORF15200"
FT                   /product="KLTH0B05456p"
FT                   /note="similar to uniprot|P38829 Saccharomyces cerevisiae
FT                   YHR122W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05456g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21587"
FT                   /db_xref="GOA:C5DCS6"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR039796"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS6"
FT                   /protein_id="CAR21587.1"
FT                   /translation="MSEFINENPDILDENLLPSRKEEEGDAFQDEALNTVNLLRRKRLL
FT                   KIHQTTACKVYRNVELIDRLKAQEMALDQVPDLTASETEESDEGEPEDPIDAQEIYDMI
FT                   AHISDPEHPLTLGQLAVVNLPDIEVSESNDKSKISEVLVKITPTITHCSLATLIGLGIR
FT                   VRLERSLPSRYRITILLKEGSHQSENQVNKQLNDKERVAAACENDQLLGVVSKMLSTCK
FT                   "
     MSEFINENPD ILDENLLPSR KEEEGDAFQD EALNTVNLLR RKRLLKIHQT TACKVYRNVE        60
     LIDRLKAQEM ALDQVPDLTA SETEESDEGE PEDPIDAQEI YDMIAHISDP EHPLTLGQLA       120
     VVNLPDIEVS ESNDKSKISE VLVKITPTIT HCSLATLIGL GIRVRLERSL PSRYRITILL       180
     KEGSHQSENQ VNKQLNDKER VAAACENDQL LGVVSKMLST CK                          222
//

If you have problems or comments...

PBIL Back to PBIL home page