(data stored in SCRATCH zone)

EMBL: CU928166.PE225

CU928166.PE225       Location/Qualifiers
FT   CDS             complement(457520..460687)
FT                   /locus_tag="KLTH0B05522g"
FT                   /old_locus_tag="KLTH-ORF15196"
FT                   /product="KLTH0B05522p"
FT                   /note="highly similar to uniprot|P53914 Saccharomyces
FT                   cerevisiae YNL132W KRE33 Essential protein of unknown
FT                   function heterozygous mutant shows haploinsufficiency in K1
FT                   killer toxin resistance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05522g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21590"
FT                   /db_xref="GOA:C5DCS9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR027992"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="InterPro:IPR033688"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCS9"
FT                   /protein_id="CAR21590.1"
FT                   /translation="MAKKAIDSRIPSLIRNGAQTKQRSFFVIVGDKARNQLPNLHYLMM
FT                   SADLKMNKSVLWAYKKKLLGFTSHRKKREAKIKKEIKRGTREVNEQDPFETFISNQNIR
FT                   YVYYKETEKILGNTYGMCILQDFEALTPNLLARTVETVEGGGIVVILLKSMTSLKQLYT
FT                   MTMDIHSRYRTEAHSDVVARFNERFILSLGSNENCLVVDDELNVLPISGGKNVQPLPPK
FT                   DEDEIPPRQQELIELKESLEDVQPAGSLVALSKTVNQAQAILNFIDAISEKNLNSTVAL
FT                   TAGRGRGKSAALGIAIAAAVSHGYSNIFVTSPSPENLKTLFEFIFKGFDALGYQEHMDY
FT                   DIIQSTNPSFNKAIVRVDIKKSHRQTIQYIVPNDSHVLGQAELVVIDEAAAIPLPVVKN
FT                   LLGPYLVFMASTINGYEGTGRSLSLKLIQQLRDQANSSGRETSETMVVSRDNKKQDFHA
FT                   SGRSLKEVVLDEPIRYAPGDPVEKWLNKLLCLDVTLIKNPRFAARGTPHPSECNLFVVN
FT                   RDTLFSYHPVSETFLEKMMALYVASHYKNSPNDLQLMSDAPAHQLFVLLPPINPKDGGR
FT                   IPDPLVVIQVALEGEISRDSVKSSLSRGQRAGGDLIPWLISQQFQDEEFPSLSGARVVR
FT                   VATNPEYSSMGYGSRAIELLRDYYEGKFADLNENSKPASHELKRVNDQELSKTNLLKDE
FT                   VKLRDAKTLPPLLLKLSEQPPHFLHYLGVSYGLTSSLHKFWKKNKFVPVYLRQTANDLT
FT                   GEHTCVMLNVLEGRESHWLSEYANDFHKRFLSLLSYEFRKFSAVQALNVIESVKKANGL
FT                   SGNAENKHAARPLTKEDIDQVLSPFDLKRLDSYANNLLDYHVIVDLLPLLSSLYFSGRM
FT                   GSSVNLSSVQSAILLAVGLQRKSVDDVSKELNLPFNQAIAMFAKIIRKFSIYFREVVSQ
FT                   SIERSMPEAKDDNIAEMNGEEVTALDASSVMEKMDDDLEKAGTRALTAMQEKQKELINS
FT                   LNLDKYAIDDNAEEWAQSKKDLDKAAKKNGTVAVKSNKKRKTENAEDIFNAEMSAVKKS
FT                   SKKKPKK"
     MAKKAIDSRI PSLIRNGAQT KQRSFFVIVG DKARNQLPNL HYLMMSADLK MNKSVLWAYK        60
     KKLLGFTSHR KKREAKIKKE IKRGTREVNE QDPFETFISN QNIRYVYYKE TEKILGNTYG       120
     MCILQDFEAL TPNLLARTVE TVEGGGIVVI LLKSMTSLKQ LYTMTMDIHS RYRTEAHSDV       180
     VARFNERFIL SLGSNENCLV VDDELNVLPI SGGKNVQPLP PKDEDEIPPR QQELIELKES       240
     LEDVQPAGSL VALSKTVNQA QAILNFIDAI SEKNLNSTVA LTAGRGRGKS AALGIAIAAA       300
     VSHGYSNIFV TSPSPENLKT LFEFIFKGFD ALGYQEHMDY DIIQSTNPSF NKAIVRVDIK       360
     KSHRQTIQYI VPNDSHVLGQ AELVVIDEAA AIPLPVVKNL LGPYLVFMAS TINGYEGTGR       420
     SLSLKLIQQL RDQANSSGRE TSETMVVSRD NKKQDFHASG RSLKEVVLDE PIRYAPGDPV       480
     EKWLNKLLCL DVTLIKNPRF AARGTPHPSE CNLFVVNRDT LFSYHPVSET FLEKMMALYV       540
     ASHYKNSPND LQLMSDAPAH QLFVLLPPIN PKDGGRIPDP LVVIQVALEG EISRDSVKSS       600
     LSRGQRAGGD LIPWLISQQF QDEEFPSLSG ARVVRVATNP EYSSMGYGSR AIELLRDYYE       660
     GKFADLNENS KPASHELKRV NDQELSKTNL LKDEVKLRDA KTLPPLLLKL SEQPPHFLHY       720
     LGVSYGLTSS LHKFWKKNKF VPVYLRQTAN DLTGEHTCVM LNVLEGRESH WLSEYANDFH       780
     KRFLSLLSYE FRKFSAVQAL NVIESVKKAN GLSGNAENKH AARPLTKEDI DQVLSPFDLK       840
     RLDSYANNLL DYHVIVDLLP LLSSLYFSGR MGSSVNLSSV QSAILLAVGL QRKSVDDVSK       900
     ELNLPFNQAI AMFAKIIRKF SIYFREVVSQ SIERSMPEAK DDNIAEMNGE EVTALDASSV       960
     MEKMDDDLEK AGTRALTAMQ EKQKELINSL NLDKYAIDDN AEEWAQSKKD LDKAAKKNGT      1020
     VAVKSNKKRK TENAEDIFNA EMSAVKKSSK KKPKK                                 1055
//

If you have problems or comments...

PBIL Back to PBIL home page