(data stored in SCRATCH zone)

EMBL: CU928166.PE229

CU928166.PE229       Location/Qualifiers
FT   CDS             complement(466200..466475)
FT                   /locus_tag="KLTH0B05632g"
FT                   /old_locus_tag="KLTH-ORF15181"
FT                   /product="KLTH0B05632p"
FT                   /note="similar to uniprot|P43497 Saccharomyces cerevisiae
FT                   YKL096W-A CWP2 major constituent of the cell wall
FT                   containing GPI-anchor, plays a role in stabilizing the cell
FT                   wall, low pH resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05632g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21594"
FT                   /db_xref="GOA:C5DCT3"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT3"
FT                   /protein_id="CAR21594.1"
FT                   /translation="MQFSTVAFAAASVAVVSAASTVQAISQIGDGQIQATTSAPATEPT
FT                   TAPTTTASWTSSGNATIPTQTENGAAAMGSGFVAMAGLAAAGALLI"
     MQFSTVAFAA ASVAVVSAAS TVQAISQIGD GQIQATTSAP ATEPTTAPTT TASWTSSGNA        60
     TIPTQTENGA AAMGSGFVAM AGLAAAGALL I                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page