(data stored in ACNUC8465 zone)

EMBL: CU928166.PE232

CU928166.PE232       Location/Qualifiers
FT   CDS             469761..471203
FT                   /locus_tag="KLTH0B05698g"
FT                   /old_locus_tag="KLTH-ORF15166"
FT                   /product="KLTH0B05698p"
FT                   /note="similar to uniprot|P27929 Saccharomyces cerevisiae
FT                   YNL137C NAM9 Mitochondrial ribosomal component of the small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05698g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21597"
FT                   /db_xref="GOA:C5DCT6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT6"
FT                   /protein_id="CAR21597.1"
FT                   /translation="MPRKAVLLKSLARGRIRSSFNKYNLFNLYKKGDVDFRSKTLYQQK
FT                   WTAKQETRAYHGEHMTEGRWQTTFTPKLDSVAQLDASLKGGEIDQTPILLQTFAVLEKR
FT                   LDFALFRAMFASSVRQARQFILHGNVFVNGIKITQPGYPLKAGDVFNVKPEKVLQALGA
FT                   KKPSLSEALKIDKLQIAVWNKYVKAIKENPREEWKRKQEKFRAMDDSNPKKQEYMEFVR
FT                   NYNKSLTAQMESEIKSATKEAILGKAVLAGSSAADPENPLVEEFLTHFYDDKALATKAV
FT                   ECFNELRNTKLIQPDAASKSVAELTEFARTLTNLTEELKNSMSDSSKKSLRAAKNIVSE
FT                   LLTSQDSVIRKLYESKKGSEETLSIPYDPLWAKRIQGHKPIDIKELAEDESKASQLINL
FT                   PWQKGLYGRQDPSKPYFTPWKPRPFLAPFAILPHHIEVSFKTCHAVYLRDPVARPGQSE
FT                   VISPFGLPVHERAYMYYVRNGK"
     MPRKAVLLKS LARGRIRSSF NKYNLFNLYK KGDVDFRSKT LYQQKWTAKQ ETRAYHGEHM        60
     TEGRWQTTFT PKLDSVAQLD ASLKGGEIDQ TPILLQTFAV LEKRLDFALF RAMFASSVRQ       120
     ARQFILHGNV FVNGIKITQP GYPLKAGDVF NVKPEKVLQA LGAKKPSLSE ALKIDKLQIA       180
     VWNKYVKAIK ENPREEWKRK QEKFRAMDDS NPKKQEYMEF VRNYNKSLTA QMESEIKSAT       240
     KEAILGKAVL AGSSAADPEN PLVEEFLTHF YDDKALATKA VECFNELRNT KLIQPDAASK       300
     SVAELTEFAR TLTNLTEELK NSMSDSSKKS LRAAKNIVSE LLTSQDSVIR KLYESKKGSE       360
     ETLSIPYDPL WAKRIQGHKP IDIKELAEDE SKASQLINLP WQKGLYGRQD PSKPYFTPWK       420
     PRPFLAPFAI LPHHIEVSFK TCHAVYLRDP VARPGQSEVI SPFGLPVHER AYMYYVRNGK       480
//

If you have problems or comments...

PBIL Back to PBIL home page