(data stored in SCRATCH zone)

EMBL: CU928166.PE233

CU928166.PE233       Location/Qualifiers
FT   CDS             complement(471311..472903)
FT                   /locus_tag="KLTH0B05720g"
FT                   /old_locus_tag="KLTH-ORF15164"
FT                   /product="KLTH0B05720p"
FT                   /note="similar to uniprot|P17555 Saccharomyces cerevisiae
FT                   YNL138W SRV2 Adenylyl cyclase-associated protein N-
FT                   terminal domain appears to be involved in cellular
FT                   responsiveness to RAS"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05720g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21598"
FT                   /db_xref="GOA:C5DCT7"
FT                   /db_xref="InterPro:IPR001837"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR013912"
FT                   /db_xref="InterPro:IPR013992"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="InterPro:IPR018106"
FT                   /db_xref="InterPro:IPR028417"
FT                   /db_xref="InterPro:IPR028419"
FT                   /db_xref="InterPro:IPR036222"
FT                   /db_xref="InterPro:IPR036223"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCT7"
FT                   /protein_id="CAR21598.1"
FT                   /translation="MSDPSNFAIQGFNLSKLLKRLEDATARLEDVTLYQEGYIQTKLED
FT                   LSVRGSSNEVEQKKTDHVTVEIPKSLPEKAEEQTEEESASVKGFRSIIDSRIEPLYQLS
FT                   EKIDPVVAKSIKHLQGAFEAQLSFLRVVSLSKKPDFGSESFIKALQPLNEQIMAIGELK
FT                   DENRQSKYFAYLNSVAEGAPLLSWIGVETPMSLIGDFKDAAQFWTNRILKDFKELDPSS
FT                   VEWVKGFLAIFDDLKSYVKEYHTTGPSWNNASGIEFAEAVAKIEGQSSKAVPSSTAPNA
FT                   SQGSGAPPPPPPPPAPPASVFEAQADKSENAGISAVFDELNQGENITKSLKKVDKSQQT
FT                   HKNPALRASSATPSARTPPPKPKKPTTLKTKKPARKELVGNKWFIEGYENVETPITIEV
FT                   NKDESVYIGNCSNVFVKIEGKVNAVSVSETERCNVVLESSVSGMDIIKSVKFAVQVEQS
FT                   LPQISIDKSDDGTIYLSKESLNAEIFTSCTTSVNVNLPIGEEGDFVEFPVPEQLKHSFA
FT                   DGKLKTTVYEHAG"
     MSDPSNFAIQ GFNLSKLLKR LEDATARLED VTLYQEGYIQ TKLEDLSVRG SSNEVEQKKT        60
     DHVTVEIPKS LPEKAEEQTE EESASVKGFR SIIDSRIEPL YQLSEKIDPV VAKSIKHLQG       120
     AFEAQLSFLR VVSLSKKPDF GSESFIKALQ PLNEQIMAIG ELKDENRQSK YFAYLNSVAE       180
     GAPLLSWIGV ETPMSLIGDF KDAAQFWTNR ILKDFKELDP SSVEWVKGFL AIFDDLKSYV       240
     KEYHTTGPSW NNASGIEFAE AVAKIEGQSS KAVPSSTAPN ASQGSGAPPP PPPPPAPPAS       300
     VFEAQADKSE NAGISAVFDE LNQGENITKS LKKVDKSQQT HKNPALRASS ATPSARTPPP       360
     KPKKPTTLKT KKPARKELVG NKWFIEGYEN VETPITIEVN KDESVYIGNC SNVFVKIEGK       420
     VNAVSVSETE RCNVVLESSV SGMDIIKSVK FAVQVEQSLP QISIDKSDDG TIYLSKESLN       480
     AEIFTSCTTS VNVNLPIGEE GDFVEFPVPE QLKHSFADGK LKTTVYEHAG                  530
//

If you have problems or comments...

PBIL Back to PBIL home page