(data stored in SCRATCH zone)

EMBL: CU928166.PE237

CU928166.PE237       Location/Qualifiers
FT   CDS             479404..480567
FT                   /locus_tag="KLTH0B05808g"
FT                   /old_locus_tag="KLTH-ORF15152"
FT                   /product="KLTH0B05808p"
FT                   /note="weakly similar to uniprot|P53901 Saccharomyces
FT                   cerevisiae YNL152W Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05808g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21602"
FT                   /db_xref="GOA:C5DCU1"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR037791"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU1"
FT                   /protein_id="CAR21602.1"
FT                   /translation="MSTVSASAFGGANGLLEVYVSRARDLPNLRKLDKQSPFVRLRISH
FT                   MTETSDVAFRGGQTPKFDYYAKFDLTPDVKPALAVEVFDDRSPPKLIGQCAVDLTPALY
FT                   KDPEDGHDDWFPLSFGSEEAGEIYLELTFHPLIPTSRLQRHRNDGISAFEESLASRPPP
FT                   PLPAKLPSFQLEKRHDEVTHNNTYSHASNLSQTLLSEPERISFGQSVSSKRMPNLDVSV
FT                   ASNSTFASQATNETHESHATVATSGTTEPLFAKLKQLKEKWNSIKNPGKDQQDHDKKVD
FT                   LEALQKVVGVEPEEFNQDERGFRRVTDVSTQASKLVTQPPLPRLPDQSSRRTSIESRAL
FT                   PTSRPNSCINETSPKLPPLPRSPSSRPDLRTRTAPNSPVRRKPPPKW"
     MSTVSASAFG GANGLLEVYV SRARDLPNLR KLDKQSPFVR LRISHMTETS DVAFRGGQTP        60
     KFDYYAKFDL TPDVKPALAV EVFDDRSPPK LIGQCAVDLT PALYKDPEDG HDDWFPLSFG       120
     SEEAGEIYLE LTFHPLIPTS RLQRHRNDGI SAFEESLASR PPPPLPAKLP SFQLEKRHDE       180
     VTHNNTYSHA SNLSQTLLSE PERISFGQSV SSKRMPNLDV SVASNSTFAS QATNETHESH       240
     ATVATSGTTE PLFAKLKQLK EKWNSIKNPG KDQQDHDKKV DLEALQKVVG VEPEEFNQDE       300
     RGFRRVTDVS TQASKLVTQP PLPRLPDQSS RRTSIESRAL PTSRPNSCIN ETSPKLPPLP       360
     RSPSSRPDLR TRTAPNSPVR RKPPPKW                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page