(data stored in ACNUC8465 zone)

EMBL: CU928166.PE239

CU928166.PE239       Location/Qualifiers
FT   CDS             complement(481757..482137)
FT                   /locus_tag="KLTH0B05852g"
FT                   /old_locus_tag="KLTH-ORF15149"
FT                   /product="KLTH0B05852p"
FT                   /note="weakly similar to uniprot|P53903 Saccharomyces
FT                   cerevisiae YNL149C Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B05852g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21604"
FT                   /db_xref="GOA:C5DCU3"
FT                   /db_xref="InterPro:IPR011431"
FT                   /db_xref="UniProtKB/TrEMBL:C5DCU3"
FT                   /protein_id="CAR21604.1"
FT                   /translation="MDFFDRAYQNLYDTFAGIDAAHAIRLVIIVGGYLLFRNLTQKHLA
FT                   KKQLEQKLRKSEEAKAAEKQKELIADPQDEETIQDNAFGWGNKTRKRVKRQEKILEERL
FT                   QELEKLQGSQDDDKDIEDLLED"
     MDFFDRAYQN LYDTFAGIDA AHAIRLVIIV GGYLLFRNLT QKHLAKKQLE QKLRKSEEAK        60
     AAEKQKELIA DPQDEETIQD NAFGWGNKTR KRVKRQEKIL EERLQELEKL QGSQDDDKDI       120
     EDLLED                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page